Protein Family IF06606
Metagenome
Isolate
163
Members
45
Samples
159
Scaffolds
273.23
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_008940|Ga0466720_008940_940_1899
- Length
- 319 aa
- Sequence
- MGNQSIKKAKKTKMNIGKQKKGKIRKKRKNMLYYAIFKEANMLKPEQKKELARKALQLRYDVLEMIGVGIAGHLGGSSSLAELIAVLYCNKMNFSADRLNDPNRDRLVISKGHAALIQYAGLCEKGCFPREELKRVKTLHGLLQGHPDCSIPGIEAVTGSLGQGLSVAVGMALALRLDKSPARVYAIMGDGEQSEGQIWEAAMAAANFKVGNLTAFIDWNKVQATGATKDIFNIPDLDKKWAAFGWNVANADGHDFEKIIEAIEKAEAVKDRPSVIILDTVKGKCFSFAEGNPAYHNGIFTEEVYQKAIRELDTIKAGI
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
31.1%
Unclassified
15.6%
Termopsidae
8.9%
Rhinotermitidae
8.9%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 34 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10125911 | 3300002462 | Bacteria | 1418 |
| 2 | Ga0466732_222708 | 3300042656 | Bacteria | 1651 |
| 3 | Ga0466705_005355 | 3300042612 | Bacteria | 12648 |
| 4 | Ga0466705_530910 | 3300042612 | Bacteria | 6628 |
| 5 | Ga0466711_171365 | 3300042615 | Bacteria | 2875 |
| 6 | Ga0466711_452483 | 3300042615 | Bacteria | 4287 |
| 7 | Ga0466715_137354 | 3300042616 | Bacteria | 4184 |
| 8 | Ga0466715_571000 | 3300042616 | Bacteria | 3453 |
| 9 | Ga0466726_045482 | 3300042619 | Bacteria | 10065 |
| 10 | Ga0466726_386545 | 3300042619 | Bacteria | 1265 |
| 11 | Ga0466728_036752 | 3300042620 | Bacteria | 3982 |
| 12 | Ga0466692_130004 | 3300042591 | Bacteria | 2478 |
| 13 | Ga0466692_173774 | 3300042591 | Bacteria | 1261 |
| 14 | Ga0466693_342795 | 3300042592 | Bacteria | 3048 |
| 15 | Ga0466691_180980 | 3300042593 | Bacteria | 11427 |
| 16 | Ga0466696_299528 | 3300042596 | Bacteria | 7410 |
| 17 | Ga0466699_001477 | 3300042597 | Bacteria | 12521 |
| 18 | Ga0466729_200749 | 3300042621 | Bacteria | 1283 |
| 19 | Ga0466702_229137 | 3300042635 | Bacteria | 1518 |
| 20 | Ga0466703_164185 | 3300042636 | Bacteria | 13810 |
| 21 | Ga0466704_153012 | 3300042643 | Bacteria | 54848 |
| 22 | Ga0466709_069036 | 3300042648 | Bacteria | 8334 |
| 23 | Ga0466707_046573 | 3300042601 | Bacteria | 1028 |
| 24 | Ga0466719_418419 | 3300042606 | Bacteria | 1769 |
| 25 | Ga0466720_151858 | 3300042607 | Bacteria | 1856 |
| 26 | Ga0466722_033931 | 3300042609 | Bacteria | 12800 |
| 27 | Ga0466722_063984 | 3300042609 | Bacteria | 16598 |
| 28 | Ga0466698_021445 | 3300042610 | Bacteria | 1759 |
| 29 | Ga0466698_149873 | 3300042610 | Bacteria | 2090 |
| 30 | Ga0466705_107762 | 3300042612 | Bacteria | 7757 |
| 31 | Ga0466723_061965 | 3300042618 | Bacteria | 1634 |
| 32 | Ga0466726_058357 | 3300042619 | Bacteria | 6981 |
| 33 | Ga0466726_188860 | 3300042619 | Bacteria | 5521 |
| 34 | Ga0466729_120574 | 3300042621 | Bacteria | 1879 |
| 35 | Ga0466690_049581 | 3300042590 | Bacteria | 3843 |
| 36 | Ga0466690_059042 | 3300042590 | Bacteria | 1363 |
| 37 | Ga0466703_085219 | 3300042636 | Bacteria | 6465 |
| 38 | Ga0466703_207668 | 3300042636 | Bacteria | 20271 |
| 39 | Ga0123357_10169704 | 3300009784 | Bacteria | 2585 |
| 40 | Ga0466707_242621 | 3300042601 | Bacteria | 1438 |
| 41 | Ga0466707_395539 | 3300042601 | Bacteria | 2958 |
| 42 | Ga0466719_117290 | 3300042606 | Unclassified | 3980 |
| 43 | Ga0466720_010760 | 3300042607 | Bacteria | 4241 |
| 44 | Ga0466705_064390 | 3300042612 | Unclassified | 7668 |
| 45 | Ga0466705_257629 | 3300042612 | Bacteria | 1281 |
| 46 | Ga0466711_198332 | 3300042615 | Bacteria | 11847 |
| 47 | Ga0466711_214922 | 3300042615 | Bacteria | 11553 |
| 48 | Ga0466718_120508 | 3300042617 | Archaea | 2299 |
| 49 | Ga0466728_295881 | 3300042620 | Bacteria | 18247 |
| 50 | Ga0466729_178881 | 3300042621 | Bacteria | 2917 |
| 51 | Ga0466690_235809 | 3300042590 | Bacteria | 3587 |
| 52 | Ga0466692_139567 | 3300042591 | Bacteria | 2121 |
| 53 | Ga0466694_119610 | 3300042594 | Bacteria | 2649 |
| 54 | Ga0466703_099574 | 3300042636 | Bacteria | 4543 |
| 55 | Ga0466703_296916 | 3300042636 | Bacteria | 11746 |
| 56 | Ga0466703_343799 | 3300042636 | Bacteria | 7809 |
| 57 | Ga0466704_439785 | 3300042643 | Bacteria | 8544 |
| 58 | Ga0466709_406816 | 3300042648 | Bacteria | 10177 |
| 59 | Ga0466727_195003 | 3300042655 | Bacteria | 6162 |
| 60 | Ga0068305_10151349 | 3300005083 | Bacteria | 2675 |
| 61 | Ga0466707_283011 | 3300042601 | Bacteria | 1182 |
| 62 | Ga0466720_089322 | 3300042607 | Unclassified | 3174 |
| 63 | Ga0466722_174138 | 3300042609 | Bacteria | 6431 |
| 64 | Ga0466722_206200 | 3300042609 | Bacteria | 5294 |
| 65 | Ga0466705_251496 | 3300042612 | Bacteria | 7979 |
| 66 | Ga0466705_457316 | 3300042612 | Bacteria | 5278 |
| 67 | Ga0466711_262896 | 3300042615 | Bacteria | 2842 |
| 68 | Ga0466711_314808 | 3300042615 | Unclassified | 2023 |
| 69 | Ga0466723_107839 | 3300042618 | Bacteria | 2178 |
| 70 | Ga0466726_231897 | 3300042619 | Unclassified | 1494 |
| 71 | Ga0466690_035799 | 3300042590 | Bacteria | 6539 |
| 72 | Ga0466692_083543 | 3300042591 | Bacteria | 3769 |
| 73 | Ga0466691_010727 | 3300042593 | Bacteria | 21088 |
| 74 | Ga0466694_031927 | 3300042594 | Bacteria | 3476 |
| 75 | Ga0466699_106766 | 3300042597 | Bacteria | 5679 |
| 76 | Ga0466729_309233 | 3300042621 | Bacteria | 3470 |
| 77 | Ga0466735_086209 | 3300042624 | Bacteria | 1065 |
| 78 | Ga0466735_231477 | 3300042624 | Bacteria | 2111 |
| 79 | Ga0466704_036882 | 3300042643 | Bacteria | 35525 |
| 80 | Ga0466704_086535 | 3300042643 | Bacteria | 19417 |
| 81 | Ga0466704_157909 | 3300042643 | Bacteria | 8145 |
| 82 | Ga0466709_366779 | 3300042648 | Bacteria | 13254 |
| 83 | Ga0466708_025646 | 3300042652 | Bacteria | 3218 |
| 84 | Ga0466708_311325 | 3300042652 | Bacteria | 25902 |
| 85 | Ga0466708_402532 | 3300042652 | Bacteria | 1414 |
| 86 | JGI24702J35022_10017679 | 3300002462 | Bacteria | 3894 |
| 87 | Ga0123356_10018919 | 3300010049 | Bacteria | 6534 |
| 88 | Ga0466732_101831 | 3300042656 | Bacteria | 9208 |
| 89 | Ga0466719_260578 | 3300042606 | Bacteria | 9429 |
| 90 | Ga0466722_050101 | 3300042609 | Bacteria | 1886 |
| 91 | Ga0466722_188102 | 3300042609 | Bacteria | 10181 |
| 92 | Ga0466711_402336 | 3300042615 | Bacteria | 2292 |
| 93 | Ga0466715_200459 | 3300042616 | Bacteria | 3189 |
| 94 | Ga0466723_278823 | 3300042618 | Bacteria | 14067 |
| 95 | Ga0466692_055865 | 3300042591 | Bacteria | 1528 |
| 96 | Ga0466709_234894 | 3300042648 | Bacteria | 6765 |
| 97 | Ga0466727_105768 | 3300042655 | Bacteria | 1022 |
| 98 | Ga0466727_294397 | 3300042655 | Bacteria | 2588 |
| 99 | AustNasuHG_c1006323 | 3300000089 | Bacteria | 4233 |
| 100 | JGI24698J34947_10000869 | 3300002449 | Bacteria | 15238 |
| 101 | Ga0466706_158509 | 3300042599 | Bacteria | 5049 |
| 102 | Ga0466707_086326 | 3300042601 | Unclassified | 1585 |
| 103 | Ga0466707_208725 | 3300042601 | Bacteria | 1144 |
| 104 | Ga0466713_094670 | 3300042602 | Bacteria | 1987 |
| 105 | Ga0466720_028434 | 3300042607 | Bacteria | 9245 |
| 106 | Ga0466720_033395 | 3300042607 | Bacteria | 3213 |
| 107 | Ga0466722_094174 | 3300042609 | Bacteria | 17191 |
| 108 | Ga0466711_227825 | 3300042615 | Bacteria | 191336 |
| 109 | Ga0466715_008577 | 3300042616 | Bacteria | 1617 |
| 110 | Ga0466723_019563 | 3300042618 | Bacteria | 12902 |
| 111 | Ga0466726_427508 | 3300042619 | Bacteria | 2200 |
| 112 | Ga0466692_116614 | 3300042591 | Bacteria | 8358 |
| 113 | Ga0466694_400486 | 3300042594 | Bacteria | 2575 |
| 114 | Ga0466696_054381 | 3300042596 | Bacteria | 22881 |
| 115 | Ga0466704_031441 | 3300042643 | Bacteria | 1128 |
| 116 | Ga0466704_072274 | 3300042643 | Bacteria | 12914 |
| 117 | Ga0466704_166593 | 3300042643 | Bacteria | 11993 |
| 118 | Ga0466709_257456 | 3300042648 | Bacteria | 4568 |
| 119 | Ga0466709_392427 | 3300042648 | Bacteria | 5812 |
| 120 | Ga0466727_138468 | 3300042655 | Bacteria | 1659 |
| 121 | Ga0466727_241613 | 3300042655 | Bacteria | 2905 |
| 122 | Ga0466727_284361 | 3300042655 | Bacteria | 3022 |
| 123 | Ga0466707_206106 | 3300042601 | Bacteria | 3562 |
| 124 | Ga0466719_220208 | 3300042606 | Bacteria | 2056 |
| 125 | Ga0466720_010868 | 3300042607 | Bacteria | 1114 |
| 126 | Ga0466722_052050 | 3300042609 | Bacteria | 3667 |
| 127 | Ga0466722_071808 | 3300042609 | Bacteria | 3244 |
| 128 | Ga0466722_188308 | 3300042609 | Bacteria | 1553 |
| 129 | Ga0466705_324741 | 3300042612 | Bacteria | 3382 |
| 130 | Ga0466712_130658 | 3300042614 | Bacteria | 3935 |
| 131 | Ga0466726_186339 | 3300042619 | Bacteria | 2700 |
| 132 | Ga0456237_0003520 | 3300041968 | Bacteria | 2532 |
| 133 | Ga0466691_073234 | 3300042593 | Bacteria | 9834 |
| 134 | Ga0466696_372044 | 3300042596 | Bacteria | 9546 |
| 135 | JGI24695J34938_10045018 | 3300002450 | Unclassified | 1959 |
| 136 | JGI24695J34938_10075949 | 3300002450 | Bacteria | 1395 |
| 137 | JGI24702J35022_10004731 | 3300002462 | Bacteria | 8053 |
| 138 | Ga0068302_10037561 | 3300005071 | Unclassified | 2927 |
| 139 | Ga0466716_125583 | 3300042605 | Bacteria | 4697 |
| 140 | Ga0466716_378245 | 3300042605 | Bacteria | 4629 |
| 141 | Ga0466719_000505 | 3300042606 | Bacteria | 7900 |
| 142 | Ga0466720_008940 | 3300042607 | Bacteria | 2507 |
| 143 | Ga0466705_168059 | 3300042612 | Bacteria | 4398 |
| 144 | Ga0466711_000085 | 3300042615 | Bacteria | 3677 |
| 145 | Ga0466726_187383 | 3300042619 | Bacteria | 19163 |
| 146 | Ga0466726_315165 | 3300042619 | Bacteria | 2519 |
| 147 | Ga0466728_258466 | 3300042620 | Bacteria | 7285 |
| 148 | Ga0456237_0002485 | 3300041968 | Unclassified | 2979 |
| 149 | Ga0466692_015405 | 3300042591 | Bacteria | 1811 |
| 150 | Ga0466691_055336 | 3300042593 | Bacteria | 3245 |
| 151 | Ga0466694_002093 | 3300042594 | Bacteria | 57040 |
| 152 | Ga0466694_377099 | 3300042594 | Bacteria | 1152 |
| 153 | Ga0466696_069891 | 3300042596 | Unclassified | 2191 |
| 154 | Ga0466703_065065 | 3300042636 | Bacteria | 10516 |
| 155 | Ga0466704_337004 | 3300042643 | Bacteria | 4436 |
| 156 | Ga0466708_109624 | 3300042652 | Bacteria | 3582 |
| 157 | Ga0466708_289104 | 3300042652 | Bacteria | 6140 |
| 158 | Ga0466727_038125 | 3300042655 | Bacteria | 1968 |
| 159 | Ga0466727_282364 | 3300042655 | Bacteria | 10266 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00456 | Transketolase_N | Transketolase, thiamine diphosphate binding domain | 62 | 299 | 0.9 |
| PF00676 | E1_dh | Dehydrogenase E1 component | 158 | 268 | 0.89 |
| PF13292 | DXP_synthase_N | 1-deoxy-D-xylulose-5-phosphate synthase | 40 | 208 | 0.79 |
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 156 | 276 | 0.71 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00676 | GO:0016624 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.