Protein Family IF06603
Metagenome
Isolate
114
Members
31
Samples
108
Scaffolds
227.11
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_001365|Ga0466720_001365_1637_2386
- Length
- 249 aa
- Sequence
- MFKKLIAFIYLKYAIIKAIIKPMAKILICDDESGLRAVIKRYAKLDRHETAEAGNGLEAVEACKKEKFDIIIMDIMMPKMDGFAAVKEIRKISDVPIIMLSARGEEYDKVSGFEYGVDDYVVKPFSSKEIMLRIAAILRRKAAVAPNKDNDGHEVFTKDGFSADMTAYKILIDGKHVELAPKLYDLLFFLIRNRGVAVPREKILTSVWGYKNIEDVRTLDTHMKLLRKAMGPYAGLITTLRGHGYRFEG
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
75.9%
Unclassified
20.7%
Kalotermitidae
3.4%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 2 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 5 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 8 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 28 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 29 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_142675 | 3300042614 | Bacteria | 2376 |
| 2 | JGI24702J35022_10000644 | 3300002462 | Bacteria | 21252 |
| 3 | JGI24702J35022_10038876 | 3300002462 | Bacteria | 2540 |
| 4 | JGI24696J40584_12934351 | 3300002834 | Bacteria | 1538 |
| 5 | Ga0072940_1105613 | 3300005200 | Bacteria | 1130 |
| 6 | Ga0123355_10123939 | 3300009826 | Bacteria | 3999 |
| 7 | Ga0123356_10569236 | 3300010049 | Bacteria | 1295 |
| 8 | Ga0123356_10760882 | 3300010049 | Bacteria | 1139 |
| 9 | Ga0466700_202006 | 3300042600 | Bacteria | 1147 |
| 10 | Ga0466720_057406 | 3300042607 | Bacteria | 28295 |
| 11 | Ga0466720_062473 | 3300042607 | Bacteria | 4577 |
| 12 | Ga0466720_093855 | 3300042607 | Bacteria | 1666 |
| 13 | Ga0264413_112950 | 3300024493 | Bacteria | 4012 |
| 14 | Ga0415639_049798 | 3300038395 | Unclassified | 2506 |
| 15 | Ga0466697_167737 | 3300042611 | Bacteria | 1023 |
| 16 | Ga0466732_386063 | 3300042656 | Bacteria | 1259 |
| 17 | Ga0466718_129075 | 3300042617 | Bacteria | 2808 |
| 18 | AustNasuHG_c1003687 | 3300000089 | Bacteria | 5520 |
| 19 | JGI24695J34938_10006353 | 3300002450 | Bacteria | 7133 |
| 20 | Ga0123356_10017175 | 3300010049 | Bacteria | 6884 |
| 21 | Ga0466719_444619 | 3300042606 | Bacteria | 5723 |
| 22 | Ga0466720_049821 | 3300042607 | Bacteria | 2733 |
| 23 | Ga0466720_095343 | 3300042607 | Bacteria | 8382 |
| 24 | Ga0466720_115601 | 3300042607 | Bacteria | 10038 |
| 25 | Ga0466732_330057 | 3300042656 | Bacteria | 3682 |
| 26 | Ga0466718_043111 | 3300042617 | Bacteria | 14634 |
| 27 | Ga0466718_049008 | 3300042617 | Bacteria | 2278 |
| 28 | Ga0466718_062608 | 3300042617 | Bacteria | 10460 |
| 29 | Ga0466718_127799 | 3300042617 | Bacteria | 1272 |
| 30 | JGI24695J34938_10079081 | 3300002450 | Bacteria | 1361 |
| 31 | Ga0123353_10016968 | 3300010167 | Bacteria | 10673 |
| 32 | Ga0123353_10195517 | 3300010167 | Unclassified | 3188 |
| 33 | Ga0123353_10696774 | 3300010167 | Bacteria | 1427 |
| 34 | Ga0123353_10734471 | 3300010167 | Bacteria | 1378 |
| 35 | Ga0466720_082703 | 3300042607 | Bacteria | 4172 |
| 36 | Ga0466721_076632 | 3300042608 | Bacteria | 4266 |
| 37 | Ga0264413_107518 | 3300024493 | Bacteria | 40797 |
| 38 | Ga0466697_127672 | 3300042611 | Unclassified | 3941 |
| 39 | Ga0466732_028780 | 3300042656 | Bacteria | 8110 |
| 40 | Ga0466732_205095 | 3300042656 | Bacteria | 27007 |
| 41 | Ga0466733_060344 | 3300042659 | Bacteria | 2120 |
| 42 | Ga0466734_026260 | 3300042623 | Bacteria | 1385 |
| 43 | Ga0466702_396283 | 3300042635 | Bacteria | 1221 |
| 44 | Ga0466718_053458 | 3300042617 | Bacteria | 1280 |
| 45 | Ga0466718_102740 | 3300042617 | Bacteria | 7869 |
| 46 | Ga0466718_161588 | 3300042617 | Bacteria | 7646 |
| 47 | AustNasuHG_c1002592 | 3300000089 | Bacteria | 6530 |
| 48 | AustNasuHG_c1029497 | 3300000089 | Unclassified | 1604 |
| 49 | JGI24702J35022_10006445 | 3300002462 | Bacteria | 6786 |
| 50 | JGI24696J40584_12960522 | 3300002834 | Bacteria | 7478 |
| 51 | Ga0072940_1015152 | 3300005200 | Bacteria | 9718 |
| 52 | Ga0123357_10045895 | 3300009784 | Bacteria | 5926 |
| 53 | Ga0123356_10012643 | 3300010049 | Bacteria | 8183 |
| 54 | Ga0123356_10251316 | 3300010049 | Bacteria | 1846 |
| 55 | Ga0123356_10803716 | 3300010049 | Bacteria | 1111 |
| 56 | Ga0466700_155719 | 3300042600 | Bacteria | 2268 |
| 57 | Ga0466720_001365 | 3300042607 | Bacteria | 2608 |
| 58 | Ga0466720_015546 | 3300042607 | Bacteria | 14883 |
| 59 | Ga0466702_093195 | 3300042635 | Bacteria | 1232 |
| 60 | Ga0466718_078599 | 3300042617 | Bacteria | 26285 |
| 61 | AustNasuHG_c1017192 | 3300000089 | Bacteria | 2410 |
| 62 | JGI24702J35022_10100319 | 3300002462 | Bacteria | 1584 |
| 63 | JGI24702J35022_10210992 | 3300002462 | Bacteria | 1115 |
| 64 | Ga0072941_1573298 | 3300005201 | Bacteria | 4653 |
| 65 | Ga0123356_10004047 | 3300010049 | Bacteria | 15219 |
| 66 | Ga0123356_10162549 | 3300010049 | Bacteria | 2232 |
| 67 | Ga0123353_10001546 | 3300010167 | Bacteria | 28184 |
| 68 | Ga0123353_10237480 | 3300010167 | Bacteria | 2835 |
| 69 | Ga0123353_10819686 | 3300010167 | Bacteria | 1281 |
| 70 | Ga0466720_050976 | 3300042607 | Bacteria | 8942 |
| 71 | Ga0466720_054711 | 3300042607 | Bacteria | 8605 |
| 72 | Ga0466720_228476 | 3300042607 | Bacteria | 22751 |
| 73 | Ga0466699_045277 | 3300042597 | Bacteria | 1648 |
| 74 | Ga0466733_164575 | 3300042659 | Bacteria | 1443 |
| 75 | Ga0466718_004164 | 3300042617 | Bacteria | 2986 |
| 76 | Ga0466718_122441 | 3300042617 | Bacteria | 1740 |
| 77 | Ga0072940_1038291 | 3300005200 | Bacteria | 17059 |
| 78 | Ga0123356_10191178 | 3300010049 | Bacteria | 2078 |
| 79 | Ga0123356_10287258 | 3300010049 | Bacteria | 1743 |
| 80 | Ga0123356_10421037 | 3300010049 | Bacteria | 1478 |
| 81 | Ga0123353_11547078 | 3300010167 | Bacteria | 841 |
| 82 | Ga0264413_116339 | 3300024493 | Unclassified | 3799 |
| 83 | Ga0466718_005899 | 3300042617 | Bacteria | 1496 |
| 84 | Ga0466718_146036 | 3300042617 | Bacteria | 15146 |
| 85 | AustNasuHG_c1000826 | 3300000089 | Bacteria | 11129 |
| 86 | AustNasuHG_c1001044 | 3300000089 | Bacteria | 9962 |
| 87 | AustNasuHG_c1003573 | 3300000089 | Bacteria | 5615 |
| 88 | Ga0072940_1093892 | 3300005200 | Unclassified | 2431 |
| 89 | Ga0123357_10028989 | 3300009784 | Bacteria | 7504 |
| 90 | Ga0123356_10937160 | 3300010049 | Bacteria | 1037 |
| 91 | Ga0123356_11133350 | 3300010049 | Bacteria | 950 |
| 92 | Ga0123353_10216036 | 3300010167 | Bacteria | 3003 |
| 93 | Ga0466700_002114 | 3300042600 | Bacteria | 1690 |
| 94 | Ga0466720_033384 | 3300042607 | Bacteria | 1311 |
| 95 | Ga0466720_105468 | 3300042607 | Bacteria | 1088 |
| 96 | Ga0466720_117744 | 3300042607 | Bacteria | 8254 |
| 97 | Ga0264413_142741 | 3300024493 | Unclassified | 3181 |
| 98 | Ga0415639_007657 | 3300038395 | Bacteria | 4015 |
| 99 | Ga0466702_271041 | 3300042635 | Bacteria | 2269 |
| 100 | Ga0466718_084149 | 3300042617 | Bacteria | 9125 |
| 101 | Ga0466718_120628 | 3300042617 | Bacteria | 7534 |
| 102 | Ga0123356_10004395 | 3300010049 | Bacteria | 14569 |
| 103 | Ga0123356_10063923 | 3300010049 | Bacteria | 3440 |
| 104 | Ga0123356_10585290 | 3300010049 | Bacteria | 1280 |
| 105 | Ga0466720_034036 | 3300042607 | Bacteria | 3007 |
| 106 | Ga0415639_105890 | 3300038395 | Bacteria | 5112 |
| 107 | Ga0466656_194671 | 3300042550 | Bacteria | 4117 |
| 108 | Ga0466699_364961 | 3300042597 | Bacteria | 6660 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00072 | GO:0000160 | phosphorelay signal transduction system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.