Protein Family IF06559
Metagenome
Isolate
167
Members
54
Samples
159
Scaffolds
159.35
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_348448|Ga0466719_348448_14361_14942
- Length
- 193 aa
- Sequence
- MKKKRRPDGFFCIFHPIDGLLRLSILHGLSMIKEMQVRDAQVLRLIERLGEHYKSNISNRFIRPALLQLPFEKQSWDLLEVLTEKSEQYRYEGFILDELYRQIAAAARFVALTRRELVPTLRNRLGGSSSGQERVLRDMAVNNFSSNLQLFADLINELYVSLTELDKAEAKGRRPLYLQMPELSDIGRMLVGN
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Kalotermitidae
26.9%
Unclassified
17.3%
Rhinotermitidae
5.8%
Termopsidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 19 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 28 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 29 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_256212 | 3300042612 | Unclassified | 3623 |
| 2 | Ga0466705_297786 | 3300042612 | Bacteria | 5232 |
| 3 | Ga0466719_054345 | 3300042606 | Bacteria | 28152 |
| 4 | Ga0466711_359023 | 3300042615 | Bacteria | 2408 |
| 5 | Ga0466715_008467 | 3300042616 | Bacteria | 6281 |
| 6 | Ga0466715_077422 | 3300042616 | Bacteria | 12481 |
| 7 | Ga0466715_254298 | 3300042616 | Bacteria | 4975 |
| 8 | Ga0466723_335793 | 3300042618 | Bacteria | 3124 |
| 9 | Ga0466690_323096 | 3300042590 | Unclassified | 2374 |
| 10 | Ga0466692_123411 | 3300042591 | Bacteria | 2677 |
| 11 | Ga0466691_149735 | 3300042593 | Unclassified | 4776 |
| 12 | Ga0466694_231002 | 3300042594 | Bacteria | 2810 |
| 13 | Ga0466694_393782 | 3300042594 | Bacteria | 1180 |
| 14 | Ga0466696_142716 | 3300042596 | Bacteria | 15106 |
| 15 | Ga0466699_127461 | 3300042597 | Bacteria | 4061 |
| 16 | Ga0466699_172291 | 3300042597 | Bacteria | 6932 |
| 17 | Ga0466709_019900 | 3300042648 | Bacteria | 2548 |
| 18 | Ga0466708_017194 | 3300042652 | Bacteria | 13361 |
| 19 | Ga0466732_456622 | 3300042656 | Bacteria | 5829 |
| 20 | Ga0123356_10270547 | 3300010049 | Unclassified | 1789 |
| 21 | Ga0123356_10961276 | 3300010049 | Bacteria | 1025 |
| 22 | Ga0123354_10548552 | 3300010882 | Bacteria | 873 |
| 23 | Ga0466715_019846 | 3300042616 | Bacteria | 9596 |
| 24 | Ga0466715_163458 | 3300042616 | Bacteria | 6518 |
| 25 | Ga0466694_069941 | 3300042594 | Bacteria | 1476 |
| 26 | Ga0466708_403992 | 3300042652 | Bacteria | 1396 |
| 27 | JGI24695J34938_10036751 | 3300002450 | Bacteria | 2230 |
| 28 | Ga0072940_1057474 | 3300005200 | Bacteria | 6207 |
| 29 | Ga0072941_1020632 | 3300005201 | Bacteria | 4894 |
| 30 | Ga0466705_248106 | 3300042612 | Bacteria | 2090 |
| 31 | Ga0466733_131201 | 3300042659 | Unclassified | 2706 |
| 32 | Ga0466706_197793 | 3300042599 | Bacteria | 1283 |
| 33 | Ga0466700_214072 | 3300042600 | Bacteria | 5423 |
| 34 | Ga0466722_235089 | 3300042609 | Bacteria | 2222 |
| 35 | Ga0466698_046692 | 3300042610 | Bacteria | 1373 |
| 36 | Ga0466712_285230 | 3300042614 | Bacteria | 5304 |
| 37 | Ga0466715_212469 | 3300042616 | Bacteria | 3860 |
| 38 | Ga0466723_229283 | 3300042618 | Bacteria | 3232 |
| 39 | Ga0466728_242542 | 3300042620 | Bacteria | 4447 |
| 40 | Ga0466693_266986 | 3300042592 | Bacteria | 14891 |
| 41 | Ga0466691_053273 | 3300042593 | Bacteria | 11646 |
| 42 | Ga0466691_115285 | 3300042593 | Bacteria | 1009 |
| 43 | Ga0466691_220799 | 3300042593 | Bacteria | 4230 |
| 44 | Ga0466694_247481 | 3300042594 | Bacteria | 16021 |
| 45 | Ga0466703_112220 | 3300042636 | Bacteria | 8358 |
| 46 | Ga0466704_022215 | 3300042643 | Bacteria | 3229 |
| 47 | Ga0466727_347900 | 3300042655 | Bacteria | 1028 |
| 48 | AustNasuHG_c1002489 | 3300000089 | Bacteria | 6671 |
| 49 | JGI24705J35276_12030565 | 3300002504 | Bacteria | 888 |
| 50 | Ga0466705_206001 | 3300042612 | Bacteria | 9478 |
| 51 | Ga0466732_297012 | 3300042656 | Bacteria | 2775 |
| 52 | Ga0123353_10190681 | 3300010167 | Bacteria | 3236 |
| 53 | Ga0123353_11296512 | 3300010167 | Bacteria | 946 |
| 54 | Ga0466722_104031 | 3300042609 | Bacteria | 2425 |
| 55 | Ga0466711_055726 | 3300042615 | Bacteria | 1560 |
| 56 | Ga0466715_185176 | 3300042616 | Bacteria | 3332 |
| 57 | Ga0466715_337373 | 3300042616 | Bacteria | 23004 |
| 58 | Ga0466715_390269 | 3300042616 | Bacteria | 3623 |
| 59 | Ga0466718_081285 | 3300042617 | Bacteria | 9186 |
| 60 | Ga0466703_197338 | 3300042636 | Bacteria | 9010 |
| 61 | Ga0466704_155010 | 3300042643 | Bacteria | 3489 |
| 62 | Ga0466709_126320 | 3300042648 | Bacteria | 20237 |
| 63 | JGI24698J34947_10006905 | 3300002449 | Bacteria | 6240 |
| 64 | JGI24702J35022_10050885 | 3300002462 | Bacteria | 2207 |
| 65 | JGI24702J35022_10701925 | 3300002462 | Bacteria | 629 |
| 66 | Ga0466732_233315 | 3300042656 | Bacteria | 1339 |
| 67 | Ga0466733_211442 | 3300042659 | Bacteria | 2180 |
| 68 | Ga0123353_10634449 | 3300010167 | Bacteria | 1517 |
| 69 | Ga0466700_103144 | 3300042600 | Bacteria | 1067 |
| 70 | Ga0466700_421292 | 3300042600 | Bacteria | 2405 |
| 71 | Ga0466717_013130 | 3300042604 | Bacteria | 1007 |
| 72 | Ga0466719_078988 | 3300042606 | Bacteria | 1102 |
| 73 | Ga0466719_414497 | 3300042606 | Bacteria | 8133 |
| 74 | Ga0466722_069097 | 3300042609 | Bacteria | 3571 |
| 75 | Ga0466722_267762 | 3300042609 | Bacteria | 3984 |
| 76 | Ga0466705_399267 | 3300042612 | Unclassified | 2113 |
| 77 | Ga0466715_309114 | 3300042616 | Bacteria | 7101 |
| 78 | Ga0466715_579983 | 3300042616 | Bacteria | 3685 |
| 79 | Ga0466718_065096 | 3300042617 | Bacteria | 4443 |
| 80 | Ga0466718_161640 | 3300042617 | Bacteria | 17146 |
| 81 | Ga0264413_122707 | 3300024493 | Bacteria | 8363 |
| 82 | Ga0466690_208441 | 3300042590 | Bacteria | 17129 |
| 83 | Ga0466699_157397 | 3300042597 | Bacteria | 2816 |
| 84 | Ga0466699_340346 | 3300042597 | Bacteria | 4871 |
| 85 | Ga0466729_205757 | 3300042621 | Bacteria | 2751 |
| 86 | Ga0466731_145495 | 3300042622 | Bacteria | 1172 |
| 87 | Ga0466704_331502 | 3300042643 | Bacteria | 21955 |
| 88 | Ga0466708_443463 | 3300042652 | Bacteria | 18075 |
| 89 | Ga0072940_1001125 | 3300005200 | Bacteria | 4118 |
| 90 | Ga0072940_1425933 | 3300005200 | Bacteria | 1561 |
| 91 | Ga0072941_1001719 | 3300005201 | Unclassified | 6742 |
| 92 | Ga0466705_014635 | 3300042612 | Bacteria | 1143 |
| 93 | Ga0466705_166127 | 3300042612 | Bacteria | 13446 |
| 94 | Ga0466732_164007 | 3300042656 | Bacteria | 1230 |
| 95 | Ga0466733_003872 | 3300042659 | Bacteria | 8153 |
| 96 | Ga0466733_034561 | 3300042659 | Bacteria | 83410 |
| 97 | Ga0466707_276443 | 3300042601 | Bacteria | 1723 |
| 98 | Ga0466717_254126 | 3300042604 | Bacteria | 1208 |
| 99 | Ga0466716_306943 | 3300042605 | Unclassified | 1685 |
| 100 | Ga0466698_068772 | 3300042610 | Bacteria | 1985 |
| 101 | Ga0466698_098998 | 3300042610 | Bacteria | 3462 |
| 102 | Ga0466711_303291 | 3300042615 | Bacteria | 9264 |
| 103 | Ga0466723_018641 | 3300042618 | Bacteria | 57830 |
| 104 | Ga0466723_138092 | 3300042618 | Bacteria | 2944 |
| 105 | Ga0466726_025349 | 3300042619 | Bacteria | 3002 |
| 106 | Ga0466690_073662 | 3300042590 | Bacteria | 2152 |
| 107 | Ga0466690_353206 | 3300042590 | Bacteria | 1722 |
| 108 | Ga0466694_027327 | 3300042594 | Bacteria | 32208 |
| 109 | Ga0466695_039534 | 3300042595 | Bacteria | 8019 |
| 110 | Ga0466703_240489 | 3300042636 | Bacteria | 2774 |
| 111 | Ga0466704_554712 | 3300042643 | Bacteria | 21699 |
| 112 | Ga0466708_006182 | 3300042652 | Bacteria | 3801 |
| 113 | Ga0466708_120813 | 3300042652 | Bacteria | 6248 |
| 114 | Ga0072941_1008388 | 3300005201 | Bacteria | 6380 |
| 115 | Ga0123355_10001621 | 3300009826 | Bacteria | 31414 |
| 116 | Ga0123353_10417610 | 3300010167 | Bacteria | 1989 |
| 117 | Ga0123353_10449130 | 3300010167 | Bacteria | 1899 |
| 118 | Ga0466722_041049 | 3300042609 | Bacteria | 22674 |
| 119 | Ga0466698_371924 | 3300042610 | Bacteria | 1090 |
| 120 | Ga0466711_337975 | 3300042615 | Bacteria | 15408 |
| 121 | Ga0466715_081756 | 3300042616 | Bacteria | 8733 |
| 122 | Ga0466715_368029 | 3300042616 | Bacteria | 7713 |
| 123 | Ga0466715_577924 | 3300042616 | Bacteria | 12430 |
| 124 | Ga0466718_006317 | 3300042617 | Bacteria | 1895 |
| 125 | Ga0466718_155045 | 3300042617 | Bacteria | 7199 |
| 126 | Ga0466729_026017 | 3300042621 | Bacteria | 1022 |
| 127 | Ga0466690_304397 | 3300042590 | Bacteria | 6014 |
| 128 | Ga0466699_089555 | 3300042597 | Bacteria | 1123 |
| 129 | Ga0466699_307954 | 3300042597 | Bacteria | 13307 |
| 130 | Ga0466704_522397 | 3300042643 | Bacteria | 6299 |
| 131 | Ga0466708_009161 | 3300042652 | Bacteria | 7299 |
| 132 | Ga0466727_145721 | 3300042655 | Bacteria | 2978 |
| 133 | AustNasuHG_c1007629 | 3300000089 | Bacteria | 3838 |
| 134 | AustNasuHG_c1008101 | 3300000089 | Bacteria | 3724 |
| 135 | JGI24695J34938_10070408 | 3300002450 | Bacteria | 1463 |
| 136 | JGI24702J35022_10045688 | 3300002462 | Bacteria | 2333 |
| 137 | JGI24702J35022_10312070 | 3300002462 | Bacteria | 931 |
| 138 | Ga0072940_1040259 | 3300005200 | Bacteria | 1639 |
| 139 | Ga0072941_1013681 | 3300005201 | Bacteria | 2728 |
| 140 | Ga0466705_238980 | 3300042612 | Bacteria | 3143 |
| 141 | Ga0123353_10574684 | 3300010167 | Bacteria | 1619 |
| 142 | Ga0123353_10664913 | 3300010167 | Bacteria | 1471 |
| 143 | Ga0123353_12171262 | 3300010167 | Bacteria | 673 |
| 144 | Ga0123354_10090314 | 3300010882 | Unclassified | 4242 |
| 145 | Ga0466700_348058 | 3300042600 | Bacteria | 2275 |
| 146 | Ga0466719_011166 | 3300042606 | Bacteria | 8868 |
| 147 | Ga0466719_348448 | 3300042606 | Bacteria | 18747 |
| 148 | Ga0466720_044105 | 3300042607 | Bacteria | 31294 |
| 149 | Ga0466720_163493 | 3300042607 | Bacteria | 5567 |
| 150 | Ga0466711_363903 | 3300042615 | Bacteria | 3631 |
| 151 | Ga0466723_343344 | 3300042618 | Bacteria | 4340 |
| 152 | Ga0466726_125830 | 3300042619 | Bacteria | 21664 |
| 153 | Ga0466691_040303 | 3300042593 | Bacteria | 3062 |
| 154 | Ga0466703_032951 | 3300042636 | Bacteria | 17490 |
| 155 | Ga0466704_439686 | 3300042643 | Bacteria | 95559 |
| 156 | Ga0466708_114421 | 3300042652 | Bacteria | 2333 |
| 157 | Ga0466727_160184 | 3300042655 | Bacteria | 1604 |
| 158 | Ga0072940_1025148 | 3300005200 | Bacteria | 1300 |
| 159 | Ga0072940_1037444 | 3300005200 | Bacteria | 1809 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.