Protein Family IF06552
Metagenome
Isolate
116
Members
34
Samples
110
Scaffolds
160.84
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_307867|Ga0466719_307867_2838_3428
- Length
- 196 aa
- Sequence
- MAFYDLTVKDAKGVEVSLSGYAGKVLLVVNTATGCGFTPQYSGLQDLYERYKDKGFEILDFPCNQFGGQAPGTNEEIGGFCAGRFGITFRQFDKIEVNGENESPLYTWLKAQKGGLGGSHIKWNFTKFLINKRGGVAPVSRRLKRPPRLRRTLDLFANPIGCRPSLTKRGAFSGCLAVVVRKLKFPNNSIVKLLEE
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.2%
Termitidae
21.9%
Tenebrionidae
15.6%
Unclassified
12.5%
Rhinotermitidae
6.2%
Vespidae
3.1%
Hodotermitidae
3.1%
Blattidae
3.1%
Termopsidae
3.1%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 11 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 12 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 13 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 31 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_002773 | 3300042612 | Bacteria | 52043 |
| 2 | Ga0466733_000828 | 3300042659 | Bacteria | 7054 |
| 3 | Ga0562375_2193 | 3300056856 | Bacteria | 22904 |
| 4 | Ga0466706_081742 | 3300042599 | Bacteria | 5871 |
| 5 | Ga0466706_099156 | 3300042599 | Bacteria | 16294 |
| 6 | Ga0466706_106445 | 3300042599 | Bacteria | 23573 |
| 7 | Ga0466706_175332 | 3300042599 | Bacteria | 7939 |
| 8 | Ga0466719_417736 | 3300042606 | Bacteria | 1183 |
| 9 | Ga0466690_429751 | 3300042590 | Bacteria | 1621 |
| 10 | Ga0466693_064356 | 3300042592 | Bacteria | 2629 |
| 11 | Ga0466704_473304 | 3300042643 | Bacteria | 2472 |
| 12 | Ga0466712_041728 | 3300042614 | Bacteria | 6992 |
| 13 | Ga0466728_040141 | 3300042620 | Bacteria | 1730 |
| 14 | Ga0466728_374344 | 3300042620 | Bacteria | 1884 |
| 15 | Ga0466705_352139 | 3300042612 | Bacteria | 14833 |
| 16 | Ga0562378_0030 | 3300056814 | Bacteria | 540869 |
| 17 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 18 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 19 | JGI24698J34947_10011305 | 3300002449 | Bacteria | 4900 |
| 20 | JGI24695J34938_10264745 | 3300002450 | Bacteria | 733 |
| 21 | Ga0466722_052494 | 3300042609 | Bacteria | 1128 |
| 22 | Ga0466691_222261 | 3300042593 | Bacteria | 5618 |
| 23 | Ga0466703_000846 | 3300042636 | Bacteria | 4626 |
| 24 | Ga0466703_194673 | 3300042636 | Bacteria | 1215 |
| 25 | Ga0466708_266858 | 3300042652 | Bacteria | 4253 |
| 26 | Ga0466705_408619 | 3300042612 | Bacteria | 7666 |
| 27 | Ga0466715_173782 | 3300042616 | Bacteria | 1671 |
| 28 | Ga0466715_428655 | 3300042616 | Bacteria | 1572 |
| 29 | Ga0466705_309044 | 3300042612 | Unclassified | 1758 |
| 30 | Ga0466706_002391 | 3300042599 | Bacteria | 31652 |
| 31 | Ga0466706_008813 | 3300042599 | Bacteria | 1220 |
| 32 | Ga0466706_072857 | 3300042599 | Bacteria | 1527 |
| 33 | Ga0466706_278094 | 3300042599 | Bacteria | 16715 |
| 34 | Ga0466714_164538 | 3300042603 | Unclassified | 2618 |
| 35 | Ga0466719_354697 | 3300042606 | Bacteria | 16235 |
| 36 | Ga0466698_093643 | 3300042610 | Bacteria | 5865 |
| 37 | Ga0466704_154932 | 3300042643 | Bacteria | 2624 |
| 38 | Ga0466704_200258 | 3300042643 | Bacteria | 54519 |
| 39 | Ga0466704_384229 | 3300042643 | Unclassified | 1892 |
| 40 | Ga0466708_061835 | 3300042652 | Bacteria | 1105 |
| 41 | Ga0466708_444843 | 3300042652 | Bacteria | 6221 |
| 42 | Ga0466705_468718 | 3300042612 | Bacteria | 1570 |
| 43 | Ga0466705_280108 | 3300042612 | Bacteria | 2646 |
| 44 | JGI24695J34938_10138836 | 3300002450 | Bacteria | 992 |
| 45 | Ga0068305_10657677 | 3300005083 | Bacteria | 1386 |
| 46 | Ga0466706_078291 | 3300042599 | Unclassified | 24091 |
| 47 | Ga0466706_097388 | 3300042599 | Bacteria | 75417 |
| 48 | Ga0466706_110379 | 3300042599 | Bacteria | 20742 |
| 49 | Ga0466706_207609 | 3300042599 | Bacteria | 4317 |
| 50 | Ga0466714_024597 | 3300042603 | Bacteria | 11745 |
| 51 | Ga0466714_083786 | 3300042603 | Bacteria | 5610 |
| 52 | Ga0466719_006540 | 3300042606 | Bacteria | 14646 |
| 53 | Ga0466722_009023 | 3300042609 | Bacteria | 4215 |
| 54 | Ga0456237_0017682 | 3300041968 | Bacteria | 999 |
| 55 | Ga0466728_093190 | 3300042620 | Bacteria | 3405 |
| 56 | Ga0466728_137237 | 3300042620 | Bacteria | 1708 |
| 57 | JGI24698J34947_10030419 | 3300002449 | Unclassified | 2847 |
| 58 | Ga0466706_030700 | 3300042599 | Bacteria | 14844 |
| 59 | Ga0466706_052408 | 3300042599 | Bacteria | 29036 |
| 60 | Ga0466722_188289 | 3300042609 | Bacteria | 3525 |
| 61 | Ga0466703_321803 | 3300042636 | Bacteria | 2932 |
| 62 | Ga0466708_051252 | 3300042652 | Bacteria | 3363 |
| 63 | Ga0466708_147304 | 3300042652 | Bacteria | 47180 |
| 64 | Ga0466715_102437 | 3300042616 | Bacteria | 8834 |
| 65 | Ga0466715_289164 | 3300042616 | Bacteria | 65907 |
| 66 | Ga0466705_014380 | 3300042612 | Bacteria | 7798 |
| 67 | Ga0466733_148158 | 3300042659 | Bacteria | 1033 |
| 68 | Ga0562376_0080 | 3300056857 | Unclassified | 227101 |
| 69 | Ga0466706_086825 | 3300042599 | Bacteria | 1329 |
| 70 | Ga0466707_034318 | 3300042601 | Bacteria | 1548 |
| 71 | Ga0466707_354977 | 3300042601 | Bacteria | 2869 |
| 72 | Ga0466714_017662 | 3300042603 | Bacteria | 15001 |
| 73 | Ga0466714_118091 | 3300042603 | Bacteria | 1025 |
| 74 | Ga0466719_307867 | 3300042606 | Bacteria | 4007 |
| 75 | Ga0466691_084917 | 3300042593 | Bacteria | 10933 |
| 76 | Ga0466703_343427 | 3300042636 | Bacteria | 1206 |
| 77 | Ga0466704_032168 | 3300042643 | Bacteria | 1023 |
| 78 | Ga0466704_061751 | 3300042643 | Unclassified | 1566 |
| 79 | Ga0466709_240593 | 3300042648 | Bacteria | 2007 |
| 80 | Ga0466708_325109 | 3300042652 | Bacteria | 5888 |
| 81 | Ga0466715_246134 | 3300042616 | Bacteria | 30355 |
| 82 | Ga0466733_159222 | 3300042659 | Bacteria | 2157 |
| 83 | Ga0562377_0010 | 3300056842 | Bacteria | 1401665 |
| 84 | Ga0562376_0242 | 3300056857 | Bacteria | 108060 |
| 85 | Ga0466706_024448 | 3300042599 | Bacteria | 1408 |
| 86 | Ga0466706_101867 | 3300042599 | Bacteria | 5199 |
| 87 | Ga0466706_204634 | 3300042599 | Bacteria | 2169 |
| 88 | Ga0466719_009049 | 3300042606 | Bacteria | 1884 |
| 89 | Ga0466719_021186 | 3300042606 | Bacteria | 1520 |
| 90 | Ga0466719_247768 | 3300042606 | Bacteria | 2177 |
| 91 | Ga0466703_013604 | 3300042636 | Bacteria | 1386 |
| 92 | Ga0466703_119826 | 3300042636 | Bacteria | 36718 |
| 93 | Ga0466708_137776 | 3300042652 | Bacteria | 2044 |
| 94 | Ga0466705_453668 | 3300042612 | Bacteria | 27283 |
| 95 | Ga0466715_458573 | 3300042616 | Bacteria | 6089 |
| 96 | Ga0466726_266806 | 3300042619 | Bacteria | 3323 |
| 97 | Ga0466728_334861 | 3300042620 | Bacteria | 1716 |
| 98 | Ga0466733_136129 | 3300042659 | Bacteria | 124918 |
| 99 | Ga0562374_0031 | 3300057007 | Bacteria | 751667 |
| 100 | JGI24695J34938_10064941 | 3300002450 | Bacteria | 1543 |
| 101 | Ga0466706_044741 | 3300042599 | Bacteria | 26230 |
| 102 | Ga0466706_062579 | 3300042599 | Bacteria | 39105 |
| 103 | Ga0466706_089648 | 3300042599 | Bacteria | 1140 |
| 104 | Ga0466706_146212 | 3300042599 | Bacteria | 13131 |
| 105 | Ga0466706_249716 | 3300042599 | Unclassified | 37265 |
| 106 | Ga0466706_288390 | 3300042599 | Bacteria | 29846 |
| 107 | Ga0466714_026004 | 3300042603 | Bacteria | 1059 |
| 108 | Ga0466704_033287 | 3300042643 | Bacteria | 1301 |
| 109 | Ga0466708_399700 | 3300042652 | Bacteria | 1456 |
| 110 | Ga0466728_403476 | 3300042620 | Bacteria | 6948 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00255 | GSHPx | Glutathione peroxidase | 3 | 110 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.