Protein Family IF06518
Metagenome
Isolate
121
Members
45
Samples
118
Scaffolds
244.45
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_205335|Ga0466719_205335_488_1345
- Length
- 285 aa
- Sequence
- MQIYNIFWFYTKLSTGTLCLTFAIFVVYLRTKQKEMNSILFCLVEEKRLGRKGGLYHKTQVNLAYNSNRIEGSRLTEEQTRYIFETRTIGFKEEEAVPVDDIIETSNHFVALDYLIDTIDTPLSNELIRTLHRILKTGTADAAKSWFPVGDWKKLPNEVGGSATTLPRDVEKEMNQLNDWYLHTTIFSLDKIIEYHYRFEKIHPFQDGNGRVGRLIMFRECLKNKITPFIIDERHKQFYYRGLKEFTSTPGYLTDTCLSAQDTYTEWVKYFYPDGGFSFPAGLDV
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
31.1%
Unclassified
8.9%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Hodotermitidae
2.2%
Blattidae
2.2%
Taxonomy
Archaea
2
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 26 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10147633 | 3300009784 | Bacteria | 2866 |
| 2 | Ga0123357_10160306 | 3300009784 | Bacteria | 2699 |
| 3 | Ga0123353_10000200 | 3300010167 | Bacteria | 76300 |
| 4 | Ga0466700_390171 | 3300042600 | Bacteria | 1759 |
| 5 | Ga0466707_176408 | 3300042601 | Archaea | 3860 |
| 6 | Ga0466714_155015 | 3300042603 | Bacteria | 1480 |
| 7 | Ga0466716_061875 | 3300042605 | Bacteria | 1630 |
| 8 | Ga0466719_152236 | 3300042606 | Bacteria | 1228 |
| 9 | Ga0466721_111723 | 3300042608 | Bacteria | 1924 |
| 10 | Ga0466735_139486 | 3300042624 | Bacteria | 1695 |
| 11 | Ga0466704_554226 | 3300042643 | Bacteria | 7356 |
| 12 | Ga0466715_324813 | 3300042616 | Bacteria | 11058 |
| 13 | Ga0466715_531736 | 3300042616 | Bacteria | 5390 |
| 14 | Ga0466728_118045 | 3300042620 | Unclassified | 1781 |
| 15 | Ga0466705_221322 | 3300042612 | Unclassified | 6855 |
| 16 | Ga0123356_10041612 | 3300010049 | Archaea | 4281 |
| 17 | Ga0123356_10539595 | 3300010049 | Bacteria | 1326 |
| 18 | Ga0123353_10060365 | 3300010167 | Bacteria | 6081 |
| 19 | Ga0466657_120220 | 3300042582 | Bacteria | 3602 |
| 20 | Ga0466690_109982 | 3300042590 | Bacteria | 42880 |
| 21 | Ga0466690_120538 | 3300042590 | Bacteria | 7496 |
| 22 | Ga0466714_138242 | 3300042603 | Bacteria | 2104 |
| 23 | Ga0466719_336419 | 3300042606 | Bacteria | 2999 |
| 24 | JGI24698J34947_10006200 | 3300002449 | Bacteria | 6570 |
| 25 | Ga0466727_201586 | 3300042655 | Bacteria | 8243 |
| 26 | Ga0466723_014070 | 3300042618 | Bacteria | 20985 |
| 27 | Ga0466729_103814 | 3300042621 | Bacteria | 4388 |
| 28 | Ga0466732_376438 | 3300042656 | Bacteria | 2266 |
| 29 | Ga0466733_099819 | 3300042659 | Bacteria | 6681 |
| 30 | Ga0123357_10120272 | 3300009784 | Bacteria | 3311 |
| 31 | Ga0123353_10874181 | 3300010167 | Bacteria | 1228 |
| 32 | Ga0466657_284474 | 3300042582 | Bacteria | 6443 |
| 33 | Ga0466692_013681 | 3300042591 | Unclassified | 8060 |
| 34 | Ga0466692_202406 | 3300042591 | Bacteria | 19489 |
| 35 | Ga0466696_446150 | 3300042596 | Bacteria | 1002 |
| 36 | Ga0466699_094634 | 3300042597 | Bacteria | 1416 |
| 37 | Ga0466719_196645 | 3300042606 | Bacteria | 7221 |
| 38 | Ga0466698_475545 | 3300042610 | Bacteria | 54574 |
| 39 | JGI24702J35022_10046459 | 3300002462 | Bacteria | 2312 |
| 40 | JGI24702J35022_10109245 | 3300002462 | Bacteria | 1520 |
| 41 | Ga0466735_013875 | 3300042624 | Bacteria | 1702 |
| 42 | Ga0466735_067196 | 3300042624 | Bacteria | 3418 |
| 43 | Ga0466709_408417 | 3300042648 | Bacteria | 5430 |
| 44 | Ga0466708_001153 | 3300042652 | Bacteria | 2306 |
| 45 | Ga0466708_005296 | 3300042652 | Bacteria | 1183 |
| 46 | Ga0466727_078029 | 3300042655 | Bacteria | 6360 |
| 47 | Ga0466729_035209 | 3300042621 | Bacteria | 2027 |
| 48 | Ga0466733_058205 | 3300042659 | Bacteria | 1542 |
| 49 | Ga0466691_102398 | 3300042593 | Bacteria | 3118 |
| 50 | Ga0466701_049550 | 3300042598 | Bacteria | 1018 |
| 51 | Ga0466707_238448 | 3300042601 | Bacteria | 5338 |
| 52 | Ga0466713_017488 | 3300042602 | Bacteria | 3387 |
| 53 | Ga0466703_018834 | 3300042636 | Bacteria | 1193 |
| 54 | Ga0466703_190608 | 3300042636 | Bacteria | 3722 |
| 55 | Ga0466704_335625 | 3300042643 | Bacteria | 6370 |
| 56 | Ga0466704_387591 | 3300042643 | Bacteria | 11446 |
| 57 | Ga0466704_436438 | 3300042643 | Bacteria | 4772 |
| 58 | Ga0466708_038412 | 3300042652 | Bacteria | 20757 |
| 59 | Ga0466708_044239 | 3300042652 | Bacteria | 19177 |
| 60 | Ga0466708_454693 | 3300042652 | Bacteria | 5429 |
| 61 | Ga0466711_088695 | 3300042615 | Bacteria | 1794 |
| 62 | Ga0466711_135908 | 3300042615 | Bacteria | 1974 |
| 63 | Ga0466711_145170 | 3300042615 | Bacteria | 12977 |
| 64 | Ga0466726_271585 | 3300042619 | Bacteria | 1526 |
| 65 | Ga0466705_047775 | 3300042612 | Bacteria | 1842 |
| 66 | Ga0466732_277433 | 3300042656 | Bacteria | 43245 |
| 67 | Ga0123353_10331481 | 3300010167 | Bacteria | 2303 |
| 68 | Ga0466695_030943 | 3300042595 | Bacteria | 1536 |
| 69 | Ga0466696_381991 | 3300042596 | Bacteria | 7309 |
| 70 | Ga0466701_072680 | 3300042598 | Bacteria | 34156 |
| 71 | Ga0466706_028370 | 3300042599 | Bacteria | 1047 |
| 72 | Ga0466713_013709 | 3300042602 | Bacteria | 106354 |
| 73 | Ga0466713_017574 | 3300042602 | Bacteria | 2163 |
| 74 | Ga0466714_107077 | 3300042603 | Bacteria | 8551 |
| 75 | Ga0466716_074570 | 3300042605 | Bacteria | 6393 |
| 76 | Ga0466716_158607 | 3300042605 | Bacteria | 5334 |
| 77 | Ga0466719_034555 | 3300042606 | Bacteria | 1298 |
| 78 | Ga0466719_115133 | 3300042606 | Bacteria | 1871 |
| 79 | Ga0466722_117769 | 3300042609 | Bacteria | 11848 |
| 80 | JGI24702J35022_10140332 | 3300002462 | Bacteria | 1348 |
| 81 | Ga0466711_130125 | 3300042615 | Bacteria | 2230 |
| 82 | Ga0466726_063621 | 3300042619 | Bacteria | 1248 |
| 83 | Ga0466726_201800 | 3300042619 | Bacteria | 2122 |
| 84 | Ga0466656_050653 | 3300042550 | Bacteria | 1035 |
| 85 | Ga0466690_192749 | 3300042590 | Bacteria | 2301 |
| 86 | Ga0466690_239292 | 3300042590 | Bacteria | 1561 |
| 87 | Ga0466700_067216 | 3300042600 | Bacteria | 2006 |
| 88 | Ga0466713_154923 | 3300042602 | Bacteria | 2310 |
| 89 | Ga0466719_022368 | 3300042606 | Bacteria | 2800 |
| 90 | Ga0466719_243168 | 3300042606 | Bacteria | 9742 |
| 91 | Ga0466719_533995 | 3300042606 | Bacteria | 5911 |
| 92 | JGI24698J34947_10046349 | 3300002449 | Bacteria | 2212 |
| 93 | Ga0466705_476239 | 3300042612 | Bacteria | 4123 |
| 94 | Ga0466723_348224 | 3300042618 | Bacteria | 7767 |
| 95 | Ga0466728_275390 | 3300042620 | Bacteria | 1827 |
| 96 | Ga0123353_10449104 | 3300010167 | Bacteria | 1899 |
| 97 | Ga0466696_300940 | 3300042596 | Unclassified | 1419 |
| 98 | Ga0466713_021884 | 3300042602 | Bacteria | 11018 |
| 99 | Ga0466719_205335 | 3300042606 | Bacteria | 2719 |
| 100 | Ga0466698_412756 | 3300042610 | Bacteria | 1074 |
| 101 | Ga0466697_023555 | 3300042611 | Bacteria | 1265 |
| 102 | JGI24702J35022_10002921 | 3300002462 | Bacteria | 10342 |
| 103 | Ga0466709_255588 | 3300042648 | Bacteria | 10384 |
| 104 | Ga0466715_217007 | 3300042616 | Bacteria | 1057 |
| 105 | Ga0466728_088969 | 3300042620 | Bacteria | 52083 |
| 106 | Ga0466733_138040 | 3300042659 | Bacteria | 15781 |
| 107 | Ga0123356_11351585 | 3300010049 | Bacteria | 874 |
| 108 | Ga0466716_159078 | 3300042605 | Bacteria | 7030 |
| 109 | Ga0466722_000297 | 3300042609 | Bacteria | 3021 |
| 110 | Ga0466735_000748 | 3300042624 | Bacteria | 1222 |
| 111 | Ga0466709_186396 | 3300042648 | Bacteria | 7764 |
| 112 | Ga0466708_013810 | 3300042652 | Bacteria | 5511 |
| 113 | Ga0466725_412714 | 3300042654 | Bacteria | 41724 |
| 114 | Ga0466710_082737 | 3300042613 | Bacteria | 18936 |
| 115 | Ga0466726_220389 | 3300042619 | Bacteria | 4047 |
| 116 | Ga0466726_444287 | 3300042619 | Bacteria | 7986 |
| 117 | Ga0466728_159880 | 3300042620 | Bacteria | 2565 |
| 118 | Ga0466728_282109 | 3300042620 | Bacteria | 52946 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02661 | Fic | Fic/DOC family | 122 | 218 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.