Protein Family IF06481
Metagenome
Isolate
220
Members
42
Samples
215
Scaffolds
408.06
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_110807|Ga0466719_110807_9683_10948
- Length
- 421 aa
- Sequence
- MMFYSLYIDPGTGSMLFSILMGAAAASFFAFRALIIKAKAFFSGGRRVAEKNSVPYIIYCEGKQYFNVFKTVLEEAEIRKTSVVYLTSAKDDPVFGMKFEYIKPEYIGEGAKAFARLNMLNADFVLMTTPGINVYQLKRSPLVKHYSHILHAPSDAVMYRLFGLDYFDSILLTGSYQARDIRALEKLRGLPEKQLVVVGCPYLDVYASKISALSRVPXXXXFTVIVSPSWGPSALLSKYGERLLSPLAKTSWRIIVRPHPQSKKSEASLLESLAKKYKDFSNIEWDYEQENIYSLSKSDVMISDFSGVIFDYIFLFNKPVLYVKQNIDLRPYDADDLYQEEAGGPLENLWQFKTVREIGVELKEESFEQIEDVIKASISSASLNEARASAKETAWERRGESGRLIFDFMTGFLNAGVDASA
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
32.5%
Unclassified
12.5%
Rhinotermitidae
7.5%
Termopsidae
7.5%
Hodotermitidae
2.5%
Blaberidae
2.5%
Taxonomy
Archaea
0
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 18 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 26 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_104712 | 3300024493 | Bacteria | 9960 |
| 2 | Ga0466692_017073 | 3300042591 | Bacteria | 5923 |
| 3 | Ga0466694_032428 | 3300042594 | Unclassified | 38124 |
| 4 | Ga0466696_097990 | 3300042596 | Bacteria | 29666 |
| 5 | Ga0466699_284753 | 3300042597 | Bacteria | 16017 |
| 6 | Ga0466699_344192 | 3300042597 | Bacteria | 3726 |
| 7 | Ga0466699_357880 | 3300042597 | Bacteria | 4020 |
| 8 | Ga0466716_073546 | 3300042605 | Unclassified | 7583 |
| 9 | Ga0466716_220912 | 3300042605 | Bacteria | 3487 |
| 10 | Ga0466720_010554 | 3300042607 | Bacteria | 31855 |
| 11 | Ga0466720_097406 | 3300042607 | Bacteria | 3111 |
| 12 | Ga0466720_177443 | 3300042607 | Bacteria | 8256 |
| 13 | Ga0466720_227070 | 3300042607 | Bacteria | 5482 |
| 14 | Ga0466722_034687 | 3300042609 | Bacteria | 3298 |
| 15 | Ga0466722_201715 | 3300042609 | Bacteria | 28386 |
| 16 | Ga0466698_495963 | 3300042610 | Bacteria | 1656 |
| 17 | AustNasuHG_c1012348 | 3300000089 | Bacteria | 2948 |
| 18 | JGI24698J34947_10000289 | 3300002449 | Bacteria | 21802 |
| 19 | Ga0466735_026334 | 3300042624 | Bacteria | 35147 |
| 20 | Ga0466703_289333 | 3300042636 | Bacteria | 30447 |
| 21 | Ga0466704_154549 | 3300042643 | Bacteria | 24370 |
| 22 | Ga0466708_009550 | 3300042652 | Bacteria | 10521 |
| 23 | Ga0466708_136238 | 3300042652 | Unclassified | 2516 |
| 24 | Ga0466727_202611 | 3300042655 | Bacteria | 6503 |
| 25 | Ga0466712_016202 | 3300042614 | Bacteria | 5195 |
| 26 | Ga0466712_106542 | 3300042614 | Bacteria | 17763 |
| 27 | Ga0466712_158108 | 3300042614 | Bacteria | 28019 |
| 28 | Ga0466715_067416 | 3300042616 | Bacteria | 21033 |
| 29 | Ga0466718_084538 | 3300042617 | Bacteria | 33255 |
| 30 | Ga0466718_140960 | 3300042617 | Unclassified | 8940 |
| 31 | Ga0466718_163095 | 3300042617 | Bacteria | 1452 |
| 32 | Ga0466723_029111 | 3300042618 | Bacteria | 4898 |
| 33 | Ga0466726_022698 | 3300042619 | Unclassified | 1259 |
| 34 | Ga0466726_103360 | 3300042619 | Bacteria | 4918 |
| 35 | Ga0466726_225086 | 3300042619 | Bacteria | 3487 |
| 36 | Ga0466729_114691 | 3300042621 | Bacteria | 5042 |
| 37 | Ga0264413_102394 | 3300024493 | Bacteria | 14440 |
| 38 | Ga0466699_118972 | 3300042597 | Bacteria | 29522 |
| 39 | Ga0466716_401258 | 3300042605 | Bacteria | 7367 |
| 40 | Ga0466720_034980 | 3300042607 | Bacteria | 11699 |
| 41 | Ga0466732_323107 | 3300042656 | Bacteria | 1340 |
| 42 | Ga0466732_350787 | 3300042656 | Bacteria | 10450 |
| 43 | AustNasuHG_c1002756 | 3300000089 | Bacteria | 6337 |
| 44 | JGI24698J34947_10000368 | 3300002449 | Bacteria | 20225 |
| 45 | JGI24698J34947_10002153 | 3300002449 | Bacteria | 10554 |
| 46 | Ga0072941_1001116 | 3300005201 | Bacteria | 50216 |
| 47 | Ga0466703_108005 | 3300042636 | Bacteria | 23863 |
| 48 | Ga0466703_308941 | 3300042636 | Bacteria | 13319 |
| 49 | Ga0466704_503878 | 3300042643 | Bacteria | 7777 |
| 50 | Ga0466709_207258 | 3300042648 | Bacteria | 4509 |
| 51 | Ga0466708_072617 | 3300042652 | Unclassified | 5004 |
| 52 | Ga0466727_343902 | 3300042655 | Bacteria | 1669 |
| 53 | Ga0466705_296546 | 3300042612 | Bacteria | 3249 |
| 54 | Ga0466705_299530 | 3300042612 | Bacteria | 1777 |
| 55 | Ga0466715_408589 | 3300042616 | Unclassified | 2277 |
| 56 | Ga0466715_489021 | 3300042616 | Bacteria | 34263 |
| 57 | Ga0466728_239996 | 3300042620 | Bacteria | 7868 |
| 58 | Ga0264413_102590 | 3300024493 | Unclassified | 13874 |
| 59 | Ga0466690_266668 | 3300042590 | Bacteria | 6484 |
| 60 | Ga0466691_010770 | 3300042593 | Bacteria | 3273 |
| 61 | Ga0466694_071384 | 3300042594 | Bacteria | 50432 |
| 62 | Ga0466696_206139 | 3300042596 | Bacteria | 15711 |
| 63 | Ga0466696_312752 | 3300042596 | Bacteria | 4281 |
| 64 | Ga0466699_102883 | 3300042597 | Bacteria | 16516 |
| 65 | Ga0466706_110741 | 3300042599 | Bacteria | 2729 |
| 66 | Ga0466716_130293 | 3300042605 | Bacteria | 3035 |
| 67 | Ga0466716_285924 | 3300042605 | Bacteria | 3163 |
| 68 | Ga0466719_434183 | 3300042606 | Unclassified | 1109 |
| 69 | Ga0466720_034936 | 3300042607 | Bacteria | 12633 |
| 70 | Ga0466720_202248 | 3300042607 | Bacteria | 3473 |
| 71 | Ga0466735_113012 | 3300042624 | Bacteria | 2526 |
| 72 | Ga0466704_107068 | 3300042643 | Bacteria | 5127 |
| 73 | Ga0466705_219569 | 3300042612 | Bacteria | 6727 |
| 74 | Ga0466715_052596 | 3300042616 | Bacteria | 17645 |
| 75 | Ga0466715_325768 | 3300042616 | Unclassified | 5401 |
| 76 | Ga0466718_025890 | 3300042617 | Bacteria | 19672 |
| 77 | Ga0466718_064681 | 3300042617 | Bacteria | 2933 |
| 78 | Ga0466726_011666 | 3300042619 | Bacteria | 6239 |
| 79 | Ga0466726_396092 | 3300042619 | Bacteria | 3341 |
| 80 | Ga0264413_104711 | 3300024493 | Bacteria | 6031 |
| 81 | Ga0466691_070038 | 3300042593 | Bacteria | 3046 |
| 82 | Ga0466694_014613 | 3300042594 | Bacteria | 3819 |
| 83 | Ga0466694_125226 | 3300042594 | Bacteria | 3266 |
| 84 | Ga0466694_354846 | 3300042594 | Bacteria | 5939 |
| 85 | Ga0466699_103184 | 3300042597 | Bacteria | 50050 |
| 86 | Ga0466699_315145 | 3300042597 | Bacteria | 5242 |
| 87 | Ga0466720_080552 | 3300042607 | Bacteria | 4831 |
| 88 | Ga0466720_100415 | 3300042607 | Bacteria | 36539 |
| 89 | Ga0466720_159313 | 3300042607 | Bacteria | 3157 |
| 90 | Ga0123356_10038001 | 3300010049 | Bacteria | 4488 |
| 91 | Ga0466732_210587 | 3300042656 | Bacteria | 4658 |
| 92 | Ga0074263_110264 | 3300005485 | Bacteria | 2267 |
| 93 | Ga0123357_10002404 | 3300009784 | Bacteria | 20853 |
| 94 | Ga0466703_169336 | 3300042636 | Bacteria | 12227 |
| 95 | Ga0466704_139785 | 3300042643 | Bacteria | 33741 |
| 96 | Ga0466704_431056 | 3300042643 | Bacteria | 5167 |
| 97 | Ga0466709_323578 | 3300042648 | Bacteria | 4839 |
| 98 | Ga0466708_046263 | 3300042652 | Bacteria | 3047 |
| 99 | Ga0466708_117800 | 3300042652 | Bacteria | 2343 |
| 100 | Ga0466727_261604 | 3300042655 | Unclassified | 5224 |
| 101 | Ga0466712_187386 | 3300042614 | Bacteria | 4864 |
| 102 | Ga0466711_285420 | 3300042615 | Unclassified | 2536 |
| 103 | Ga0466715_003157 | 3300042616 | Bacteria | 16477 |
| 104 | Ga0466718_029813 | 3300042617 | Bacteria | 16333 |
| 105 | Ga0466718_036685 | 3300042617 | Bacteria | 20442 |
| 106 | Ga0466723_036192 | 3300042618 | Bacteria | 13182 |
| 107 | Ga0466723_121627 | 3300042618 | Bacteria | 5725 |
| 108 | Ga0466728_036256 | 3300042620 | Bacteria | 3892 |
| 109 | Ga0466728_151219 | 3300042620 | Bacteria | 2602 |
| 110 | Ga0466690_303104 | 3300042590 | Bacteria | 1549 |
| 111 | Ga0466694_038629 | 3300042594 | Bacteria | 6145 |
| 112 | Ga0466699_206802 | 3300042597 | Bacteria | 5900 |
| 113 | Ga0466699_311467 | 3300042597 | Bacteria | 10260 |
| 114 | Ga0466707_067863 | 3300042601 | Bacteria | 11167 |
| 115 | Ga0466720_036827 | 3300042607 | Bacteria | 40262 |
| 116 | Ga0466720_167266 | 3300042607 | Unclassified | 4781 |
| 117 | Ga0466722_161957 | 3300042609 | Bacteria | 3251 |
| 118 | AustNasuHG_c1000328 | 3300000089 | Bacteria | 16453 |
| 119 | AustNasuHG_c1000575 | 3300000089 | Bacteria | 12960 |
| 120 | JGI24698J34947_10000004 | 3300002449 | Bacteria | 62550 |
| 121 | JGI24698J34947_10001459 | 3300002449 | Unclassified | 12451 |
| 122 | JGI24698J34947_10028975 | 3300002449 | Bacteria | 2929 |
| 123 | Ga0466735_232819 | 3300042624 | Bacteria | 8693 |
| 124 | Ga0466703_158216 | 3300042636 | Bacteria | 4064 |
| 125 | Ga0466705_062628 | 3300042612 | Bacteria | 3250 |
| 126 | Ga0466712_184515 | 3300042614 | Bacteria | 4391 |
| 127 | Ga0466712_307642 | 3300042614 | Bacteria | 17229 |
| 128 | Ga0466711_078545 | 3300042615 | Bacteria | 10279 |
| 129 | Ga0466711_497257 | 3300042615 | Bacteria | 16499 |
| 130 | Ga0466718_058641 | 3300042617 | Bacteria | 14058 |
| 131 | Ga0466723_114374 | 3300042618 | Bacteria | 17921 |
| 132 | Ga0466728_206774 | 3300042620 | Bacteria | 1365 |
| 133 | Ga0264413_102586 | 3300024493 | Bacteria | 3751 |
| 134 | Ga0264413_104713 | 3300024493 | Bacteria | 35389 |
| 135 | Ga0466690_035562 | 3300042590 | Bacteria | 5819 |
| 136 | Ga0466690_431548 | 3300042590 | Bacteria | 1676 |
| 137 | Ga0466691_076827 | 3300042593 | Unclassified | 4832 |
| 138 | Ga0466694_391332 | 3300042594 | Bacteria | 3240 |
| 139 | Ga0466720_029809 | 3300042607 | Bacteria | 15349 |
| 140 | Ga0466720_043999 | 3300042607 | Bacteria | 22878 |
| 141 | Ga0466722_123129 | 3300042609 | Bacteria | 25771 |
| 142 | Ga0123353_10200817 | 3300010167 | Bacteria | 3137 |
| 143 | Ga0466732_044252 | 3300042656 | Bacteria | 27068 |
| 144 | Ga0466732_243001 | 3300042656 | Bacteria | 1768 |
| 145 | Ga0466732_263718 | 3300042656 | Bacteria | 8482 |
| 146 | AustNasuHG_c1000343 | 3300000089 | Bacteria | 16215 |
| 147 | AustNasuHG_c1002225 | 3300000089 | Bacteria | 7002 |
| 148 | Ga0466703_005026 | 3300042636 | Bacteria | 8123 |
| 149 | Ga0466709_243675 | 3300042648 | Bacteria | 1602 |
| 150 | Ga0466708_058582 | 3300042652 | Unclassified | 1494 |
| 151 | Ga0466727_112894 | 3300042655 | Bacteria | 1618 |
| 152 | Ga0466705_083961 | 3300042612 | Bacteria | 6009 |
| 153 | Ga0466705_246027 | 3300042612 | Bacteria | 50897 |
| 154 | Ga0466705_336812 | 3300042612 | Bacteria | 1872 |
| 155 | Ga0466712_140520 | 3300042614 | Bacteria | 3179 |
| 156 | Ga0466712_263912 | 3300042614 | Bacteria | 2322 |
| 157 | Ga0466711_223943 | 3300042615 | Bacteria | 11621 |
| 158 | Ga0466715_560471 | 3300042616 | Unclassified | 2196 |
| 159 | Ga0466718_073755 | 3300042617 | Bacteria | 1390 |
| 160 | Ga0466723_260220 | 3300042618 | Unclassified | 3471 |
| 161 | Ga0466723_277495 | 3300042618 | Bacteria | 2821 |
| 162 | Ga0466728_003555 | 3300042620 | Bacteria | 15475 |
| 163 | Ga0466728_375825 | 3300042620 | Bacteria | 2280 |
| 164 | Ga0264413_101011 | 3300024493 | Bacteria | 11928 |
| 165 | Ga0264413_157774 | 3300024493 | Bacteria | 2656 |
| 166 | Ga0466696_263241 | 3300042596 | Bacteria | 32707 |
| 167 | Ga0466696_420605 | 3300042596 | Bacteria | 3008 |
| 168 | Ga0466699_100233 | 3300042597 | Unclassified | 8067 |
| 169 | Ga0466699_122743 | 3300042597 | Bacteria | 38385 |
| 170 | Ga0466699_216336 | 3300042597 | Bacteria | 25050 |
| 171 | Ga0466716_005800 | 3300042605 | Bacteria | 10859 |
| 172 | Ga0466716_265661 | 3300042605 | Bacteria | 5239 |
| 173 | Ga0466719_343202 | 3300042606 | Bacteria | 5370 |
| 174 | Ga0466720_082328 | 3300042607 | Bacteria | 18267 |
| 175 | Ga0466722_072167 | 3300042609 | Bacteria | 4590 |
| 176 | AustNasuHG_c1004483 | 3300000089 | Bacteria | 5007 |
| 177 | JGI24698J34947_10001119 | 3300002449 | Bacteria | 13853 |
| 178 | JGI24698J34947_10031801 | 3300002449 | Bacteria | 2774 |
| 179 | Ga0466703_224136 | 3300042636 | Unclassified | 2230 |
| 180 | Ga0466704_032402 | 3300042643 | Bacteria | 1786 |
| 181 | Ga0466704_250294 | 3300042643 | Bacteria | 4051 |
| 182 | Ga0466708_031087 | 3300042652 | Bacteria | 4655 |
| 183 | Ga0466708_141296 | 3300042652 | Bacteria | 14270 |
| 184 | Ga0466705_498510 | 3300042612 | Bacteria | 11485 |
| 185 | Ga0466712_077826 | 3300042614 | Bacteria | 33172 |
| 186 | Ga0466712_171107 | 3300042614 | Bacteria | 22554 |
| 187 | Ga0466712_180228 | 3300042614 | Bacteria | 13858 |
| 188 | Ga0466718_139708 | 3300042617 | Bacteria | 35662 |
| 189 | Ga0466718_162500 | 3300042617 | Bacteria | 6383 |
| 190 | Ga0466726_061883 | 3300042619 | Bacteria | 1464 |
| 191 | Ga0466728_380881 | 3300042620 | Bacteria | 39953 |
| 192 | Ga0264413_102690 | 3300024493 | Bacteria | 13996 |
| 193 | Ga0264413_112833 | 3300024493 | Bacteria | 9548 |
| 194 | Ga0466691_097301 | 3300042593 | Bacteria | 5495 |
| 195 | Ga0466694_383462 | 3300042594 | Bacteria | 3480 |
| 196 | Ga0466696_002438 | 3300042596 | Unclassified | 2603 |
| 197 | Ga0466699_036827 | 3300042597 | Bacteria | 2694 |
| 198 | Ga0466699_314214 | 3300042597 | Bacteria | 2081 |
| 199 | Ga0466707_227106 | 3300042601 | Bacteria | 6822 |
| 200 | Ga0466719_110807 | 3300042606 | Bacteria | 31505 |
| 201 | Ga0466720_013468 | 3300042607 | Bacteria | 13046 |
| 202 | Ga0466720_029258 | 3300042607 | Bacteria | 50082 |
| 203 | Ga0466720_112435 | 3300042607 | Bacteria | 45324 |
| 204 | Ga0466720_145662 | 3300042607 | Bacteria | 157622 |
| 205 | Ga0123356_10000085 | 3300010049 | Bacteria | 98249 |
| 206 | AustNasuHG_c1001624 | 3300000089 | Bacteria | 8105 |
| 207 | AustNasuHG_c1025420 | 3300000089 | Bacteria | 1860 |
| 208 | Ga0466735_082530 | 3300042624 | Bacteria | 24525 |
| 209 | Ga0466704_100028 | 3300042643 | Unclassified | 4099 |
| 210 | Ga0466708_163385 | 3300042652 | Bacteria | 2406 |
| 211 | Ga0466708_176210 | 3300042652 | Bacteria | 7272 |
| 212 | Ga0466705_352587 | 3300042612 | Bacteria | 1431 |
| 213 | Ga0466715_114435 | 3300042616 | Bacteria | 19834 |
| 214 | Ga0466718_129224 | 3300042617 | Bacteria | 36457 |
| 215 | Ga0466718_138034 | 3300042617 | Unclassified | 5455 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04464 | Glyphos_transf | CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase | 238 | 328 | 0.65 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.