Protein Family IF06457
Metagenome
Isolate
141
Members
52
Samples
132
Scaffolds
173.89
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_051482|Ga0466719_051482_5034_5633
- Length
- 199 aa
- Sequence
- MDNYKQRLKGITTFIFDFDGVLTDGRIWVYKDSWAQRCASVKDGYALHYASKIGYNIAVISSGSGTSIHERMNSIGISDVYTEVHSKIDKFYEYIASKNVHPDEVLYMGDDIPDYEVMREAGIACCPADAAQEIKDIAHYISPIKGGEGCVRDVIEQVLKTRNDWFNGDLLTDEFAADGFATGNMSASDRAKRDLATKW
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Kalotermitidae
25.5%
Unclassified
19.6%
Passalidae
2.0%
Rhinotermitidae
2.0%
Termopsidae
2.0%
Taxonomy
Archaea
2
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 45 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 51 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 52 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_259852 | 3300042612 | Bacteria | 8472 |
| 2 | Ga0466732_440280 | 3300042656 | Bacteria | 3194 |
| 3 | Ga0466656_256079 | 3300042550 | Bacteria | 14023 |
| 4 | Ga0466694_078100 | 3300042594 | Bacteria | 1068 |
| 5 | Ga0466694_377867 | 3300042594 | Bacteria | 1638 |
| 6 | Ga0466713_037273 | 3300042602 | Bacteria | 14703 |
| 7 | Ga0466714_001571 | 3300042603 | Bacteria | 1512 |
| 8 | Ga0466717_104506 | 3300042604 | Bacteria | 1118 |
| 9 | Ga0466719_051482 | 3300042606 | Bacteria | 11957 |
| 10 | Ga0466728_301691 | 3300042620 | Bacteria | 2325 |
| 11 | IMNBL1DRAFT_c0048282 | 3300000062 | Bacteria | 1367 |
| 12 | JGI24702J35022_10037888 | 3300002462 | Bacteria | 2575 |
| 13 | JGI24702J35022_10287528 | 3300002462 | Unclassified | 967 |
| 14 | JGI24696J40584_12812910 | 3300002834 | Unclassified | 892 |
| 15 | JGI24696J40584_12829436 | 3300002834 | Bacteria | 927 |
| 16 | JGI24696J40584_12938283 | 3300002834 | Bacteria | 1624 |
| 17 | Ga0072940_1384937 | 3300005200 | Bacteria | 1556 |
| 18 | Ga0123353_10092076 | 3300010167 | Bacteria | 4883 |
| 19 | Ga0123353_10337549 | 3300010167 | Bacteria | 2278 |
| 20 | Ga0123354_10560167 | 3300010882 | Bacteria | 857 |
| 21 | Ga0466709_219154 | 3300042648 | Bacteria | 176728 |
| 22 | Ga0466691_010908 | 3300042593 | Bacteria | 139266 |
| 23 | Ga0466694_257341 | 3300042594 | Bacteria | 3501 |
| 24 | Ga0466695_384511 | 3300042595 | Bacteria | 1640 |
| 25 | Ga0466701_044258 | 3300042598 | Bacteria | 7614 |
| 26 | Ga0466714_075023 | 3300042603 | Bacteria | 1269 |
| 27 | Ga0466697_029141 | 3300042611 | Bacteria | 3178 |
| 28 | Ga0466710_079034 | 3300042613 | Bacteria | 7300 |
| 29 | Ga0466710_157830 | 3300042613 | Bacteria | 1323 |
| 30 | Ga0466710_259733 | 3300042613 | Unclassified | 2516 |
| 31 | Ga0466710_397029 | 3300042613 | Bacteria | 2064 |
| 32 | Ga0466711_064920 | 3300042615 | Bacteria | 3423 |
| 33 | Ga0466728_227695 | 3300042620 | Bacteria | 1593 |
| 34 | Ga0123353_10492177 | 3300010167 | Archaea | 1790 |
| 35 | Ga0466731_033920 | 3300042622 | Bacteria | 1124 |
| 36 | Ga0466697_177978 | 3300042611 | Bacteria | 3627 |
| 37 | Ga0466690_171267 | 3300042590 | Bacteria | 1397 |
| 38 | Ga0466693_171279 | 3300042592 | Unclassified | 2253 |
| 39 | Ga0466693_369119 | 3300042592 | Unclassified | 1169 |
| 40 | Ga0466696_407335 | 3300042596 | Bacteria | 10253 |
| 41 | Ga0466701_054012 | 3300042598 | Bacteria | 1618 |
| 42 | Ga0466700_468496 | 3300042600 | Bacteria | 1682 |
| 43 | Ga0466713_029120 | 3300042602 | Bacteria | 25153 |
| 44 | Ga0466716_344336 | 3300042605 | Bacteria | 1698 |
| 45 | Ga0466710_091019 | 3300042613 | Bacteria | 1698 |
| 46 | Ga0466711_306020 | 3300042615 | Bacteria | 14460 |
| 47 | JGI24702J35022_10021006 | 3300002462 | Bacteria | 3544 |
| 48 | JGI24696J40584_12745727 | 3300002834 | Bacteria | 788 |
| 49 | JGI24696J40584_12956435 | 3300002834 | Unclassified | 3112 |
| 50 | Ga0123353_10083331 | 3300010167 | Unclassified | 5145 |
| 51 | Ga0123353_10373417 | 3300010167 | Bacteria | 2137 |
| 52 | Ga0466731_224533 | 3300042622 | Bacteria | 1584 |
| 53 | Ga0466697_133382 | 3300042611 | Bacteria | 1948 |
| 54 | Ga0466732_407413 | 3300042656 | Bacteria | 11602 |
| 55 | Ga0466694_000066 | 3300042594 | Bacteria | 1553 |
| 56 | Ga0466699_365120 | 3300042597 | Bacteria | 1363 |
| 57 | Ga0466714_060501 | 3300042603 | Bacteria | 1912 |
| 58 | Ga0466717_088692 | 3300042604 | Bacteria | 3198 |
| 59 | IMNBL1DRAFT_c0026603 | 3300000062 | Bacteria | 2193 |
| 60 | JGI24702J35022_10005772 | 3300002462 | Bacteria | 7217 |
| 61 | JGI24702J35022_10098503 | 3300002462 | Unclassified | 1598 |
| 62 | JGI24696J40584_12779243 | 3300002834 | Bacteria | 834 |
| 63 | Ga0123353_10068689 | 3300010167 | Bacteria | 5691 |
| 64 | Ga0123354_10437606 | 3300010882 | Bacteria | 1071 |
| 65 | Ga0466733_085233 | 3300042659 | Bacteria | 1343 |
| 66 | Ga0466733_155139 | 3300042659 | Bacteria | 4951 |
| 67 | Ga0466695_285341 | 3300042595 | Bacteria | 15370 |
| 68 | Ga0466696_163814 | 3300042596 | Bacteria | 11226 |
| 69 | Ga0466699_428055 | 3300042597 | Bacteria | 2828 |
| 70 | Ga0466701_029013 | 3300042598 | Bacteria | 55485 |
| 71 | Ga0466721_132773 | 3300042608 | Bacteria | 2314 |
| 72 | Ga0466718_151104 | 3300042617 | Bacteria | 1396 |
| 73 | Ga0466726_040199 | 3300042619 | Bacteria | 1645 |
| 74 | JGI24702J35022_10146836 | 3300002462 | Bacteria | 1320 |
| 75 | JGI24702J35022_10299709 | 3300002462 | Unclassified | 948 |
| 76 | JGI24696J40584_12902950 | 3300002834 | Unclassified | 1198 |
| 77 | Ga0123356_10017744 | 3300010049 | Bacteria | 6763 |
| 78 | Ga0123356_10296885 | 3300010049 | Bacteria | 1719 |
| 79 | Ga0123356_11067642 | 3300010049 | Bacteria | 976 |
| 80 | Ga0123353_10001068 | 3300010167 | Bacteria | 33438 |
| 81 | Ga0123353_10055834 | 3300010167 | Bacteria | 6319 |
| 82 | Ga0123353_10384666 | 3300010167 | Bacteria | 2097 |
| 83 | Ga0123353_11319352 | 3300010167 | Bacteria | 935 |
| 84 | Ga0466731_026478 | 3300042622 | Bacteria | 1602 |
| 85 | Ga0466733_100403 | 3300042659 | Bacteria | 17688 |
| 86 | Ga0466693_153369 | 3300042592 | Unclassified | 1412 |
| 87 | Ga0466714_069461 | 3300042603 | Bacteria | 5575 |
| 88 | Ga0466722_021635 | 3300042609 | Bacteria | 5615 |
| 89 | Ga0466698_492435 | 3300042610 | Bacteria | 3136 |
| 90 | Ga0466710_342983 | 3300042613 | Bacteria | 1135 |
| 91 | Ga0466711_128935 | 3300042615 | Bacteria | 5191 |
| 92 | JGI24702J35022_10009751 | 3300002462 | Unclassified | 5387 |
| 93 | JGI24696J40584_12961717 | 3300002834 | Bacteria | 71305 |
| 94 | Ga0466703_344358 | 3300042636 | Bacteria | 3909 |
| 95 | Ga0466709_093275 | 3300042648 | Bacteria | 36721 |
| 96 | Ga0466724_34635 | 3300042649 | Bacteria | 4564 |
| 97 | Ga0466708_448570 | 3300042652 | Bacteria | 6869 |
| 98 | Ga0466697_248782 | 3300042611 | Bacteria | 4171 |
| 99 | Ga0466657_287488 | 3300042582 | Bacteria | 12282 |
| 100 | Ga0466657_336503 | 3300042582 | Bacteria | 11282 |
| 101 | Ga0466690_209109 | 3300042590 | Bacteria | 4988 |
| 102 | Ga0466693_269579 | 3300042592 | Bacteria | 1272 |
| 103 | Ga0466691_010104 | 3300042593 | Bacteria | 3961 |
| 104 | Ga0466694_030584 | 3300042594 | Bacteria | 71743 |
| 105 | Ga0466701_000734 | 3300042598 | Bacteria | 2774 |
| 106 | Ga0466701_087404 | 3300042598 | Bacteria | 17906 |
| 107 | Ga0466710_088391 | 3300042613 | Bacteria | 4346 |
| 108 | Ga0466710_092678 | 3300042613 | Bacteria | 1202 |
| 109 | Ga0466723_055836 | 3300042618 | Unclassified | 2345 |
| 110 | Ga0072941_1371311 | 3300005201 | Bacteria | 2100 |
| 111 | Ga0123356_11067924 | 3300010049 | Bacteria | 976 |
| 112 | Ga0123353_10076854 | 3300010167 | Bacteria | 5365 |
| 113 | Ga0466731_119043 | 3300042622 | Bacteria | 1553 |
| 114 | Ga0466703_215694 | 3300042636 | Bacteria | 2583 |
| 115 | Ga0466732_422030 | 3300042656 | Bacteria | 1354 |
| 116 | Ga0466695_221908 | 3300042595 | Bacteria | 1004 |
| 117 | Ga0466699_293031 | 3300042597 | Bacteria | 2609 |
| 118 | Ga0466699_373654 | 3300042597 | Bacteria | 2054 |
| 119 | Ga0466701_103406 | 3300042598 | Bacteria | 2119 |
| 120 | Ga0466722_224357 | 3300042609 | Bacteria | 3938 |
| 121 | Ga0466715_449024 | 3300042616 | Bacteria | 2454 |
| 122 | Ga0466728_099517 | 3300042620 | Archaea | 2997 |
| 123 | JGI24702J35022_10002809 | 3300002462 | Bacteria | 10558 |
| 124 | JGI24702J35022_10037194 | 3300002462 | Bacteria | 2600 |
| 125 | JGI24702J35022_10055409 | 3300002462 | Unclassified | 2115 |
| 126 | Ga0123353_10000970 | 3300010167 | Bacteria | 35107 |
| 127 | Ga0123353_10001295 | 3300010167 | Bacteria | 30680 |
| 128 | Ga0123353_10039258 | 3300010167 | Bacteria | 7450 |
| 129 | Ga0123353_10907092 | 3300010167 | Bacteria | 1199 |
| 130 | Ga0123354_10138151 | 3300010882 | Bacteria | 3033 |
| 131 | Ga0466731_195536 | 3300042622 | Bacteria | 24605 |
| 132 | Ga0466731_249595 | 3300042622 | Bacteria | 1767 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.