Protein Family IF06449
Metagenome
Isolate
145
Members
45
Samples
141
Scaffolds
274.48
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_027696|Ga0466719_027696_802_1809
- Length
- 335 aa
- Sequence
- MSRDEASEVRRHIAMCPRSFGFYDRANFLLSRRNSTPIPLCPAPHQRIPTKPFHNPPVLCYHAFMDRIIACIGSGNMGAALMKGVANVTGGGAIGLADVDKSKAKQVAEQMGATVYSSNAEAVQEADVVFLAVKPQALQTALEEVASIIKKRAESTRPATLVSMAAGWSIARIQAIVGKTPVVRIMPDTPALIGKGVIAYTPSPETPESVIEEIRGMLSQTGVVDRLDEAYLNAVTGLSGSGPAFVCLFIEALADGGVRAGLPRDKALRYAAQTALGSAAMILETGKHPAELKDMVASPAGTTIAGVAALEAGAFCGVVMNAVHEAFKRAAELDS
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.5%
Kalotermitidae
32.6%
Unclassified
14.0%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Taxonomy
Archaea
1
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 7 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 38 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 39 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_346974 | 3300042656 | Bacteria | 1315 |
| 2 | Ga0466707_360733 | 3300042601 | Bacteria | 2423 |
| 3 | Ga0466717_265124 | 3300042604 | Bacteria | 1060 |
| 4 | Ga0466698_182160 | 3300042610 | Bacteria | 1320 |
| 5 | Ga0466708_243043 | 3300042652 | Bacteria | 7958 |
| 6 | JGI24698J34947_10009238 | 3300002449 | Bacteria | 5408 |
| 7 | JGI24695J34938_10001037 | 3300002450 | Bacteria | 25193 |
| 8 | Ga0466711_055020 | 3300042615 | Bacteria | 11087 |
| 9 | Ga0466718_085360 | 3300042617 | Bacteria | 1251 |
| 10 | Ga0466728_041530 | 3300042620 | Bacteria | 8906 |
| 11 | Ga0466728_460472 | 3300042620 | Bacteria | 70404 |
| 12 | Ga0466729_040216 | 3300042621 | Bacteria | 3859 |
| 13 | Ga0123355_10185929 | 3300009826 | Unclassified | 3072 |
| 14 | Ga0123353_10001183 | 3300010167 | Bacteria | 31899 |
| 15 | Ga0466692_060728 | 3300042591 | Bacteria | 21885 |
| 16 | Ga0466692_095379 | 3300042591 | Bacteria | 6266 |
| 17 | Ga0466691_015703 | 3300042593 | Bacteria | 14471 |
| 18 | Ga0466719_218678 | 3300042606 | Bacteria | 2975 |
| 19 | Ga0466722_096496 | 3300042609 | Bacteria | 15946 |
| 20 | Ga0466735_089115 | 3300042624 | Bacteria | 1252 |
| 21 | Ga0466704_304316 | 3300042643 | Unclassified | 4933 |
| 22 | Ga0466709_205317 | 3300042648 | Bacteria | 10596 |
| 23 | Ga0466709_354124 | 3300042648 | Bacteria | 4200 |
| 24 | Ga0466712_133645 | 3300042614 | Bacteria | 7385 |
| 25 | Ga0466715_451022 | 3300042616 | Unclassified | 1666 |
| 26 | Ga0466723_269607 | 3300042618 | Bacteria | 3069 |
| 27 | Ga0466728_082860 | 3300042620 | Bacteria | 16094 |
| 28 | Ga0123355_10697971 | 3300009826 | Bacteria | 1166 |
| 29 | Ga0264413_124401 | 3300024493 | Bacteria | 15449 |
| 30 | Ga0466690_335182 | 3300042590 | Bacteria | 3165 |
| 31 | Ga0466696_138013 | 3300042596 | Bacteria | 2225 |
| 32 | Ga0466696_395028 | 3300042596 | Unclassified | 2799 |
| 33 | Ga0466699_084136 | 3300042597 | Bacteria | 29498 |
| 34 | Ga0466699_387112 | 3300042597 | Bacteria | 1292 |
| 35 | Ga0466716_259323 | 3300042605 | Bacteria | 3348 |
| 36 | Ga0466719_027696 | 3300042606 | Bacteria | 5177 |
| 37 | Ga0466709_261273 | 3300042648 | Bacteria | 9956 |
| 38 | Ga0466708_147328 | 3300042652 | Bacteria | 8131 |
| 39 | Ga0466727_071273 | 3300042655 | Bacteria | 7238 |
| 40 | Ga0466727_322173 | 3300042655 | Bacteria | 2084 |
| 41 | Ga0072941_1008547 | 3300005201 | Bacteria | 10665 |
| 42 | Ga0072941_1103568 | 3300005201 | Unclassified | 1044 |
| 43 | Ga0466715_299417 | 3300042616 | Bacteria | 33411 |
| 44 | Ga0466718_022888 | 3300042617 | Bacteria | 1010 |
| 45 | Ga0264413_111170 | 3300024493 | Bacteria | 2988 |
| 46 | Ga0466705_267896 | 3300042612 | Bacteria | 25002 |
| 47 | Ga0466732_195011 | 3300042656 | Bacteria | 2597 |
| 48 | Ga0466707_309931 | 3300042601 | Bacteria | 1783 |
| 49 | Ga0466720_213355 | 3300042607 | Unclassified | 1698 |
| 50 | Ga0466721_131552 | 3300042608 | Bacteria | 9596 |
| 51 | Ga0466735_167075 | 3300042624 | Bacteria | 12081 |
| 52 | Ga0466703_127639 | 3300042636 | Bacteria | 26700 |
| 53 | Ga0466704_287655 | 3300042643 | Bacteria | 4182 |
| 54 | Ga0466704_378265 | 3300042643 | Bacteria | 4465 |
| 55 | Ga0466708_173978 | 3300042652 | Bacteria | 12012 |
| 56 | JGI24695J34938_10000442 | 3300002450 | Bacteria | 40061 |
| 57 | Ga0072941_1057153 | 3300005201 | Bacteria | 13983 |
| 58 | Ga0074263_101112 | 3300005485 | Bacteria | 1334 |
| 59 | Ga0074263_106602 | 3300005485 | Bacteria | 1404 |
| 60 | Ga0466726_023150 | 3300042619 | Bacteria | 1159 |
| 61 | Ga0466726_449591 | 3300042619 | Bacteria | 1882 |
| 62 | Ga0123355_10298927 | 3300009826 | Bacteria | 2197 |
| 63 | Ga0466690_248653 | 3300042590 | Bacteria | 4285 |
| 64 | Ga0466732_254934 | 3300042656 | Bacteria | 1167 |
| 65 | Ga0466707_133011 | 3300042601 | Bacteria | 4141 |
| 66 | Ga0466717_258945 | 3300042604 | Archaea | 1601 |
| 67 | Ga0466716_019255 | 3300042605 | Bacteria | 2513 |
| 68 | Ga0466716_360973 | 3300042605 | Bacteria | 11141 |
| 69 | Ga0466720_178912 | 3300042607 | Bacteria | 1023 |
| 70 | Ga0466731_038999 | 3300042622 | Bacteria | 2620 |
| 71 | Ga0466735_208678 | 3300042624 | Bacteria | 9776 |
| 72 | Ga0466704_218768 | 3300042643 | Bacteria | 93221 |
| 73 | Ga0466708_410876 | 3300042652 | Bacteria | 1898 |
| 74 | AustNasuHG_c1002095 | 3300000089 | Bacteria | 7212 |
| 75 | Ga0072941_1072692 | 3300005201 | Bacteria | 3248 |
| 76 | Ga0466711_163300 | 3300042615 | Bacteria | 4960 |
| 77 | Ga0123353_10825591 | 3300010167 | Bacteria | 1275 |
| 78 | Ga0466690_027904 | 3300042590 | Bacteria | 14673 |
| 79 | Ga0466692_013126 | 3300042591 | Unclassified | 1468 |
| 80 | Ga0466696_078624 | 3300042596 | Bacteria | 1565 |
| 81 | Ga0466705_085521 | 3300042612 | Bacteria | 5710 |
| 82 | Ga0466732_207002 | 3300042656 | Bacteria | 2842 |
| 83 | Ga0466707_097052 | 3300042601 | Bacteria | 2008 |
| 84 | Ga0466722_206817 | 3300042609 | Unclassified | 2802 |
| 85 | Ga0466722_207506 | 3300042609 | Bacteria | 18414 |
| 86 | Ga0466735_065058 | 3300042624 | Bacteria | 1751 |
| 87 | Ga0466704_074184 | 3300042643 | Bacteria | 5874 |
| 88 | Ga0466704_475978 | 3300042643 | Bacteria | 49461 |
| 89 | Ga0466708_050854 | 3300042652 | Bacteria | 13177 |
| 90 | Ga0466705_481127 | 3300042612 | Bacteria | 1121 |
| 91 | Ga0466715_155890 | 3300042616 | Bacteria | 5070 |
| 92 | Ga0466715_304310 | 3300042616 | Bacteria | 10525 |
| 93 | Ga0466723_070329 | 3300042618 | Bacteria | 4597 |
| 94 | Ga0123355_10233444 | 3300009826 | Bacteria | 2622 |
| 95 | Ga0264413_122316 | 3300024493 | Bacteria | 1425 |
| 96 | Ga0264413_122317 | 3300024493 | Bacteria | 1439 |
| 97 | Ga0466692_005944 | 3300042591 | Bacteria | 3815 |
| 98 | Ga0466692_049912 | 3300042591 | Bacteria | 28578 |
| 99 | Ga0466692_059253 | 3300042591 | Bacteria | 13317 |
| 100 | Ga0466691_136884 | 3300042593 | Bacteria | 8077 |
| 101 | Ga0466691_195402 | 3300042593 | Bacteria | 42238 |
| 102 | Ga0466694_049840 | 3300042594 | Bacteria | 19608 |
| 103 | Ga0466705_030977 | 3300042612 | Bacteria | 16381 |
| 104 | Ga0466707_031017 | 3300042601 | Bacteria | 1357 |
| 105 | Ga0466719_071109 | 3300042606 | Bacteria | 7043 |
| 106 | Ga0466720_133028 | 3300042607 | Bacteria | 1314 |
| 107 | Ga0466722_006015 | 3300042609 | Bacteria | 10617 |
| 108 | Ga0466735_055680 | 3300042624 | Bacteria | 1091 |
| 109 | Ga0466703_095090 | 3300042636 | Bacteria | 24169 |
| 110 | Ga0466703_234187 | 3300042636 | Bacteria | 6768 |
| 111 | Ga0466703_291513 | 3300042636 | Bacteria | 1416 |
| 112 | Ga0466704_092422 | 3300042643 | Bacteria | 19924 |
| 113 | Ga0466708_089288 | 3300042652 | Bacteria | 29795 |
| 114 | Ga0466708_315657 | 3300042652 | Bacteria | 53502 |
| 115 | Ga0466708_396941 | 3300042652 | Bacteria | 5175 |
| 116 | Nasutiter_Contig05766 | 2030936001 | Bacteria | 1960 |
| 117 | Ga0068305_10827518 | 3300005083 | Bacteria | 5419 |
| 118 | Ga0466711_018935 | 3300042615 | Bacteria | 46101 |
| 119 | Ga0466726_007194 | 3300042619 | Bacteria | 1092 |
| 120 | Ga0466726_398689 | 3300042619 | Bacteria | 9246 |
| 121 | Ga0123355_10007288 | 3300009826 | Bacteria | 16545 |
| 122 | Ga0466690_313579 | 3300042590 | Bacteria | 41778 |
| 123 | Ga0466692_029056 | 3300042591 | Bacteria | 2618 |
| 124 | Ga0466691_071917 | 3300042593 | Bacteria | 1829 |
| 125 | Ga0466694_158998 | 3300042594 | Bacteria | 17627 |
| 126 | Ga0466727_351368 | 3300042655 | Bacteria | 2218 |
| 127 | Ga0466732_289918 | 3300042656 | Bacteria | 2158 |
| 128 | Ga0466707_328487 | 3300042601 | Bacteria | 2540 |
| 129 | Ga0466716_219241 | 3300042605 | Bacteria | 3406 |
| 130 | Ga0466719_122514 | 3300042606 | Bacteria | 1234 |
| 131 | Ga0466722_223826 | 3300042609 | Bacteria | 6717 |
| 132 | Ga0466703_359274 | 3300042636 | Bacteria | 2952 |
| 133 | Ga0466704_141943 | 3300042643 | Bacteria | 51616 |
| 134 | Ga0466704_392713 | 3300042643 | Bacteria | 2310 |
| 135 | Ga0466708_396616 | 3300042652 | Bacteria | 3580 |
| 136 | Ga0466715_143794 | 3300042616 | Bacteria | 10515 |
| 137 | Ga0466718_001132 | 3300042617 | Bacteria | 1734 |
| 138 | Ga0466723_008383 | 3300042618 | Bacteria | 5484 |
| 139 | Ga0466690_283388 | 3300042590 | Bacteria | 14677 |
| 140 | Ga0466692_049660 | 3300042591 | Bacteria | 16113 |
| 141 | Ga0466696_436012 | 3300042596 | Bacteria | 28892 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14748 | P5CR_dimer | Pyrroline-5-carboxylate reductase dimerisation | 229 | 333 | 0.98 |
| PF01408 | GFO_IDH_MocA | Oxidoreductase family, NAD-binding Rossmann fold | 69 | 137 | 0.89 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 69 | 147 | 0.86 |
| PF03446 | NAD_binding_2 | NAD binding domain of 6-phosphogluconate dehydrogenase | 69 | 147 | 0.84 |
| PF02153 | PDH_N | Prephenate dehydrogenase, nucleotide-binding domain | 95 | 153 | 0.83 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
| PF03446 | GO:0050661 | NADP binding | MF |
| PF02153 | GO:0070403 | NAD+ binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.