Protein Family IF06413
Metagenome
Metatranscriptome
168
Members
39
Samples
168
Scaffolds
115.57
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_412293|Ga0466716_412293_16412_16774
- Length
- 120 aa
- Sequence
- MRLDISRVRIFIRPGYTDLREAVNGLSLLIEQEMEGDPFSGNVYLFCNRGRKLLKALWWDRNGFWLSRKRRTCGSLEQEKFPWPENGEAVRELSGEELQMLLRGIDFFKAHKELYYKKIS
Sample Types
Isolate
0.0%
Metagenome
99.4%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
72.2%
Kalotermitidae
25.0%
Rhinotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 20 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 21 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 22 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome | |
| 23 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_159526 | 3300042656 | Bacteria | 1230 |
| 2 | Ga0466715_301766 | 3300042616 | Bacteria | 2104 |
| 3 | Ga0466718_073498 | 3300042617 | Bacteria | 1352 |
| 4 | Ga0466718_164547 | 3300042617 | Bacteria | 2607 |
| 5 | Ga0466717_219598 | 3300042604 | Bacteria | 1933 |
| 6 | Ga0466720_155429 | 3300042607 | Bacteria | 1461 |
| 7 | Ga0466720_180350 | 3300042607 | Bacteria | 1775 |
| 8 | Ga0466721_248913 | 3300042608 | Bacteria | 3234 |
| 9 | Ga0466702_315843 | 3300042635 | Bacteria | 1442 |
| 10 | Ga0466703_375789 | 3300042636 | Bacteria | 1476 |
| 11 | Ga0466708_187955 | 3300042652 | Bacteria | 2235 |
| 12 | Ga0223676_1045808 | 3300021232 | Bacteria | 764 |
| 13 | Ga0466656_268162 | 3300042550 | Bacteria | 1280 |
| 14 | Ga0466657_046305 | 3300042582 | Bacteria | 2980 |
| 15 | Ga0466694_161209 | 3300042594 | Bacteria | 1603 |
| 16 | Ga0466695_022632 | 3300042595 | Bacteria | 2278 |
| 17 | Ga0466699_018171 | 3300042597 | Bacteria | 5021 |
| 18 | Ga0466699_029073 | 3300042597 | Bacteria | 4683 |
| 19 | Ga0466699_168999 | 3300042597 | Bacteria | 1019 |
| 20 | AustNasuHG_c1036040 | 3300000089 | Bacteria | 1291 |
| 21 | AustNasuHG_c1038177 | 3300000089 | Bacteria | 1213 |
| 22 | AustNasuHG_c1058848 | 3300000089 | Bacteria | 757 |
| 23 | FAAS_10180402 | 3300001880 | Bacteria | 527 |
| 24 | Ga0466697_216104 | 3300042611 | Bacteria | 1172 |
| 25 | Ga0466732_008267 | 3300042656 | Bacteria | 1178 |
| 26 | Ga0466732_346773 | 3300042656 | Bacteria | 2603 |
| 27 | Ga0466701_024084 | 3300042598 | Bacteria | 1699 |
| 28 | Ga0466717_256831 | 3300042604 | Bacteria | 1034 |
| 29 | Ga0466720_023666 | 3300042607 | Bacteria | 1664 |
| 30 | Ga0466720_087985 | 3300042607 | Bacteria | 13900 |
| 31 | Ga0466720_176204 | 3300042607 | Bacteria | 1068 |
| 32 | Ga0466731_207108 | 3300042622 | Bacteria | 1118 |
| 33 | Ga0466702_377929 | 3300042635 | Bacteria | 1006 |
| 34 | Ga0466702_417324 | 3300042635 | Bacteria | 2486 |
| 35 | Ga0466702_433080 | 3300042635 | Bacteria | 1342 |
| 36 | Ga0264413_105887 | 3300024493 | Unclassified | 1721 |
| 37 | Ga0466691_118980 | 3300042593 | Bacteria | 2404 |
| 38 | Ga0466695_057522 | 3300042595 | Bacteria | 2925 |
| 39 | Ga0466696_053418 | 3300042596 | Bacteria | 2240 |
| 40 | Ga0123356_13386646 | 3300010049 | Bacteria | 554 |
| 41 | AustNasuHG_c1021443 | 3300000089 | Unclassified | 2092 |
| 42 | AustNasuHG_c1049444 | 3300000089 | Bacteria | 914 |
| 43 | Ga0074263_111095 | 3300005485 | Bacteria | 1034 |
| 44 | Ga0466697_225533 | 3300042611 | Unclassified | 2249 |
| 45 | Ga0466717_047505 | 3300042604 | Bacteria | 2127 |
| 46 | Ga0466720_029661 | 3300042607 | Bacteria | 1462 |
| 47 | Ga0466720_100380 | 3300042607 | Bacteria | 3043 |
| 48 | Ga0466720_103107 | 3300042607 | Bacteria | 1439 |
| 49 | Ga0466720_137966 | 3300042607 | Bacteria | 8068 |
| 50 | Ga0466720_204925 | 3300042607 | Unclassified | 1679 |
| 51 | Ga0466720_216507 | 3300042607 | Bacteria | 1171 |
| 52 | Ga0466698_141391 | 3300042610 | Bacteria | 1226 |
| 53 | Ga0466698_310768 | 3300042610 | Bacteria | 1612 |
| 54 | Ga0466702_195892 | 3300042635 | Unclassified | 1114 |
| 55 | Ga0466702_197009 | 3300042635 | Bacteria | 1124 |
| 56 | Ga0466709_120463 | 3300042648 | Bacteria | 4309 |
| 57 | Ga0264413_105961 | 3300024493 | Bacteria | 2469 |
| 58 | Ga0466656_384145 | 3300042550 | Bacteria | 2346 |
| 59 | Ga0466695_390255 | 3300042595 | Bacteria | 1852 |
| 60 | Nasutiter_Contig00110 | 2030936001 | Bacteria | 988 |
| 61 | AustNasuHG_c1043036 | 3300000089 | Bacteria | 1066 |
| 62 | Ga0466732_078175 | 3300042656 | Bacteria | 1269 |
| 63 | Ga0466732_206002 | 3300042656 | Bacteria | 1113 |
| 64 | Ga0466718_056663 | 3300042617 | Bacteria | 1121 |
| 65 | Ga0466701_041740 | 3300042598 | Bacteria | 1104 |
| 66 | Ga0466700_009263 | 3300042600 | Bacteria | 1481 |
| 67 | Ga0466698_036232 | 3300042610 | Bacteria | 1208 |
| 68 | Ga0466702_132471 | 3300042635 | Bacteria | 2411 |
| 69 | Ga0466657_203878 | 3300042582 | Bacteria | 1007 |
| 70 | Ga0466694_385415 | 3300042594 | Bacteria | 1005 |
| 71 | AustNasuHG_c1072341 | 3300000089 | Bacteria | 615 |
| 72 | JGI24696J40584_12808083 | 3300002834 | Bacteria | 882 |
| 73 | Ga0466718_080504 | 3300042617 | Bacteria | 1026 |
| 74 | Ga0466718_128038 | 3300042617 | Bacteria | 2153 |
| 75 | Ga0466723_314290 | 3300042618 | Bacteria | 4586 |
| 76 | Ga0466716_412293 | 3300042605 | Bacteria | 17153 |
| 77 | Ga0466720_053196 | 3300042607 | Bacteria | 2783 |
| 78 | Ga0466720_133113 | 3300042607 | Unclassified | 1095 |
| 79 | Ga0466720_164975 | 3300042607 | Bacteria | 1275 |
| 80 | Ga0466698_057912 | 3300042610 | Bacteria | 1023 |
| 81 | Ga0466698_095125 | 3300042610 | Bacteria | 2723 |
| 82 | Ga0466734_136889 | 3300042623 | Bacteria | 2729 |
| 83 | Ga0466702_055313 | 3300042635 | Bacteria | 1000 |
| 84 | Ga0466702_194360 | 3300042635 | Bacteria | 1074 |
| 85 | Ga0466709_363595 | 3300042648 | Bacteria | 2185 |
| 86 | Ga0466690_174289 | 3300042590 | Bacteria | 7435 |
| 87 | Ga0466694_050527 | 3300042594 | Bacteria | 3341 |
| 88 | Ga0466694_078953 | 3300042594 | Bacteria | 1412 |
| 89 | Ga0466694_370152 | 3300042594 | Bacteria | 1643 |
| 90 | Ga0466701_013144 | 3300042598 | Bacteria | 1045 |
| 91 | Nasutiter_Contig04437 | 2030936001 | Bacteria | 1310 |
| 92 | AustNasuHG_c1004409 | 3300000089 | Bacteria | 5048 |
| 93 | AustNasuHG_c1005557 | 3300000089 | Unclassified | 4507 |
| 94 | AustNasuHG_c1006079 | 3300000089 | Bacteria | 4314 |
| 95 | AustNasuHG_c1019532 | 3300000089 | Unclassified | 2222 |
| 96 | AustNasuHG_c1025041 | 3300000089 | Bacteria | 1881 |
| 97 | AustNasuHG_c1036312 | 3300000089 | Bacteria | 1281 |
| 98 | AustNasuHG_c1041345 | 3300000089 | Unclassified | 1112 |
| 99 | AustNasuHG_c1045714 | 3300000089 | Bacteria | 997 |
| 100 | FAAS_10003783 | 3300001880 | Bacteria | 859 |
| 101 | Ga0074263_112660 | 3300005485 | Bacteria | 2761 |
| 102 | Ga0074263_113036 | 3300005485 | Unclassified | 3325 |
| 103 | Ga0466718_104733 | 3300042617 | Bacteria | 1115 |
| 104 | Ga0466701_017167 | 3300042598 | Unclassified | 1844 |
| 105 | Ga0466701_039091 | 3300042598 | Bacteria | 1698 |
| 106 | Ga0466720_009376 | 3300042607 | Bacteria | 1247 |
| 107 | Ga0466720_050921 | 3300042607 | Bacteria | 1526 |
| 108 | Ga0466720_072526 | 3300042607 | Bacteria | 11119 |
| 109 | Ga0466698_037464 | 3300042610 | Bacteria | 1079 |
| 110 | Ga0466731_299480 | 3300042622 | Bacteria | 1607 |
| 111 | Ga0466734_169737 | 3300042623 | Bacteria | 2119 |
| 112 | Ga0466694_066776 | 3300042594 | Bacteria | 2566 |
| 113 | Ga0466694_069943 | 3300042594 | Bacteria | 1130 |
| 114 | Ga0466694_209693 | 3300042594 | Bacteria | 1248 |
| 115 | Ga0466699_074295 | 3300042597 | Bacteria | 11581 |
| 116 | Ga0123357_10311101 | 3300009784 | Bacteria | 1573 |
| 117 | AustNasuHG_c1013277 | 3300000089 | Unclassified | 2827 |
| 118 | AustNasuHG_c1015052 | 3300000089 | Bacteria | 2617 |
| 119 | AustNasuHG_c1034523 | 3300000089 | Unclassified | 1352 |
| 120 | AustNasuHG_c1040349 | 3300000089 | Bacteria | 1142 |
| 121 | AustNasuHG_c1046115 | 3300000089 | Unclassified | 988 |
| 122 | AustNasuHG_c1047740 | 3300000089 | Unclassified | 950 |
| 123 | AustNasuHG_c1054585 | 3300000089 | Bacteria | 820 |
| 124 | Ga0072940_1028564 | 3300005200 | Bacteria | 2380 |
| 125 | Ga0074263_107104 | 3300005485 | Unclassified | 2286 |
| 126 | Ga0074263_109641 | 3300005485 | Bacteria | 3408 |
| 127 | Ga0074263_117060 | 3300005485 | Bacteria | 834 |
| 128 | Ga0466732_184089 | 3300042656 | Bacteria | 3118 |
| 129 | Ga0466710_456957 | 3300042613 | Bacteria | 1524 |
| 130 | Ga0466715_012650 | 3300042616 | Bacteria | 1040 |
| 131 | Ga0466701_066288 | 3300042598 | Bacteria | 2869 |
| 132 | Ga0466700_428407 | 3300042600 | Bacteria | 1142 |
| 133 | Ga0466717_009436 | 3300042604 | Bacteria | 1853 |
| 134 | Ga0466717_135122 | 3300042604 | Bacteria | 1975 |
| 135 | Ga0466720_046844 | 3300042607 | Bacteria | 1833 |
| 136 | Ga0466720_058295 | 3300042607 | Bacteria | 1497 |
| 137 | Ga0466720_130435 | 3300042607 | Unclassified | 1613 |
| 138 | Ga0466722_181494 | 3300042609 | Bacteria | 3856 |
| 139 | Ga0466731_131607 | 3300042622 | Bacteria | 1468 |
| 140 | Ga0466734_172865 | 3300042623 | Bacteria | 1988 |
| 141 | Ga0466702_354117 | 3300042635 | Bacteria | 1461 |
| 142 | Ga0466656_165446 | 3300042550 | Bacteria | 1960 |
| 143 | Ga0123353_11419050 | 3300010167 | Bacteria | 891 |
| 144 | Nasutiter_Contig47445 | 2030936001 | Bacteria | 2107 |
| 145 | AustNasuHG_c1017900 | 3300000089 | Unclassified | 2346 |
| 146 | Ga0466715_159216 | 3300042616 | Bacteria | 2434 |
| 147 | Ga0466715_181802 | 3300042616 | Bacteria | 1987 |
| 148 | Ga0466718_084757 | 3300042617 | Bacteria | 1746 |
| 149 | Ga0466701_077893 | 3300042598 | Bacteria | 1664 |
| 150 | Ga0466717_306906 | 3300042604 | Bacteria | 3133 |
| 151 | Ga0466720_016200 | 3300042607 | Bacteria | 12750 |
| 152 | Ga0466720_016855 | 3300042607 | Bacteria | 1774 |
| 153 | Ga0466720_027730 | 3300042607 | Unclassified | 1150 |
| 154 | Ga0466720_055515 | 3300042607 | Bacteria | 20645 |
| 155 | Ga0466720_077910 | 3300042607 | Bacteria | 2999 |
| 156 | Ga0466720_237064 | 3300042607 | Bacteria | 1375 |
| 157 | Ga0466702_047072 | 3300042635 | Bacteria | 1350 |
| 158 | Ga0466702_427902 | 3300042635 | Bacteria | 1710 |
| 159 | Ga0466703_331397 | 3300042636 | Unclassified | 1283 |
| 160 | Ga0466657_113121 | 3300042582 | Bacteria | 3214 |
| 161 | Ga0466694_066513 | 3300042594 | Bacteria | 1709 |
| 162 | Ga0466694_344345 | 3300042594 | Bacteria | 1375 |
| 163 | Ga0466695_068846 | 3300042595 | Bacteria | 2711 |
| 164 | Ga0466699_180490 | 3300042597 | Bacteria | 1879 |
| 165 | Ga0123357_10780154 | 3300009784 | Bacteria | 654 |
| 166 | JGI24696J40584_12948593 | 3300002834 | Bacteria | 2014 |
| 167 | Ga0074263_104800 | 3300005485 | Bacteria | 2661 |
| 168 | Ga0074263_110687 | 3300005485 | Unclassified | 2323 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042594 | Ga0466694_066513 | Ga0466694_066513_524_823 | 99 |
| 2 | 3300042597 | Ga0466699_168999 | Ga0466699_168999_21_335 | 104 |
| 3 | 3300042595 | Ga0466695_022632 | Ga0466695_022632_226_570 | 114 |
| 4 | 3300042607 | Ga0466720_027730 | Ga0466720_027730_601_945 | 114 |
| 5 | 2030936001 | Nasutiter_Contig00110 | Nasutiterm_1795740 | 115 |
| 6 | 2030936001 | Nasutiter_Contig47445 | Nasutiterm_211410 | 115 |
| 7 | 3300021232 | Ga0223676_1045808 | Ga0223676_10458082 | 115 |
| 8 | 3300024493 | Ga0264413_105887 | Ga0264413_1058872 | 115 |
| 9 | 3300024493 | Ga0264413_105961 | Ga0264413_1059613 | 115 |
| 10 | 3300042550 | Ga0466656_165446 | Ga0466656_165446_1085_1432 | 115 |
| 11 | 3300042550 | Ga0466656_268162 | Ga0466656_268162_129_476 | 115 |
| 12 | 3300042550 | Ga0466656_384145 | Ga0466656_384145_293_640 | 115 |
| 13 | 3300042582 | Ga0466657_046305 | Ga0466657_046305_1744_2091 | 115 |
| 14 | 3300042582 | Ga0466657_113121 | Ga0466657_113121_458_805 | 115 |
| 15 | 3300042582 | Ga0466657_203878 | Ga0466657_203878_449_796 | 115 |
| 16 | 3300042590 | Ga0466690_174289 | Ga0466690_174289_6860_7207 | 115 |
| 17 | 3300042593 | Ga0466691_118980 | Ga0466691_118980_761_1108 | 115 |
| 18 | 3300042594 | Ga0466694_050527 | Ga0466694_050527_1057_1404 | 115 |
| 19 | 3300042594 | Ga0466694_069943 | Ga0466694_069943_733_1080 | 115 |
| 20 | 3300042594 | Ga0466694_078953 | Ga0466694_078953_525_872 | 115 |
| 21 | 3300042594 | Ga0466694_161209 | Ga0466694_161209_1181_1528 | 115 |
| 22 | 3300042594 | Ga0466694_209693 | Ga0466694_209693_876_1223 | 115 |
| 23 | 3300042594 | Ga0466694_344345 | Ga0466694_344345_466_813 | 115 |
| 24 | 3300042594 | Ga0466694_370152 | Ga0466694_370152_692_1039 | 115 |
| 25 | 3300042594 | Ga0466694_385415 | Ga0466694_385415_209_556 | 115 |
| 26 | 3300042595 | Ga0466695_057522 | Ga0466695_057522_1830_2177 | 115 |
| 27 | 3300042595 | Ga0466695_068846 | Ga0466695_068846_1807_2154 | 115 |
| 28 | 3300042595 | Ga0466695_390255 | Ga0466695_390255_1078_1425 | 115 |
| 29 | 3300042596 | Ga0466696_053418 | Ga0466696_053418_1863_2210 | 115 |
| 30 | 3300042597 | Ga0466699_018171 | Ga0466699_018171_4571_4918 | 115 |
| 31 | 3300042597 | Ga0466699_029073 | Ga0466699_029073_4114_4461 | 115 |
| 32 | 3300042597 | Ga0466699_074295 | Ga0466699_074295_9496_9843 | 115 |
| 33 | 3300042597 | Ga0466699_180490 | Ga0466699_180490_427_774 | 115 |
| 34 | 3300042598 | Ga0466701_013144 | Ga0466701_013144_251_598 | 115 |
| 35 | 3300042598 | Ga0466701_017167 | Ga0466701_017167_469_816 | 115 |
| 36 | 3300042598 | Ga0466701_024084 | Ga0466701_024084_771_1118 | 115 |
| 37 | 3300042598 | Ga0466701_039091 | Ga0466701_039091_253_600 | 115 |
| 38 | 3300042598 | Ga0466701_041740 | Ga0466701_041740_329_676 | 115 |
| 39 | 3300042598 | Ga0466701_066288 | Ga0466701_066288_1921_2268 | 115 |
| 40 | 3300042598 | Ga0466701_077893 | Ga0466701_077893_1154_1501 | 115 |
| 41 | 3300042600 | Ga0466700_009263 | Ga0466700_009263_484_831 | 115 |
| 42 | 3300042600 | Ga0466700_428407 | Ga0466700_428407_406_753 | 115 |
| 43 | 3300042604 | Ga0466717_009436 | Ga0466717_009436_263_610 | 115 |
| 44 | 3300042604 | Ga0466717_047505 | Ga0466717_047505_1114_1461 | 115 |
| 45 | 3300042604 | Ga0466717_135122 | Ga0466717_135122_1480_1827 | 115 |
| 46 | 3300042604 | Ga0466717_219598 | Ga0466717_219598_1014_1361 | 115 |
| 47 | 3300042604 | Ga0466717_256831 | Ga0466717_256831_72_419 | 115 |
| 48 | 3300042604 | Ga0466717_306906 | Ga0466717_306906_809_1156 | 115 |
| 49 | 3300042607 | Ga0466720_016200 | Ga0466720_016200_1352_1699 | 115 |
| 50 | 3300042607 | Ga0466720_016855 | Ga0466720_016855_75_422 | 115 |
| 51 | 3300042607 | Ga0466720_023666 | Ga0466720_023666_401_748 | 115 |
| 52 | 3300042607 | Ga0466720_029661 | Ga0466720_029661_473_820 | 115 |
| 53 | 3300042607 | Ga0466720_046844 | Ga0466720_046844_1232_1579 | 115 |
| 54 | 3300042607 | Ga0466720_050921 | Ga0466720_050921_1048_1395 | 115 |
| 55 | 3300042607 | Ga0466720_053196 | Ga0466720_053196_375_722 | 115 |
| 56 | 3300042607 | Ga0466720_058295 | Ga0466720_058295_486_833 | 115 |
| 57 | 3300042607 | Ga0466720_072526 | Ga0466720_072526_3291_3638 | 115 |
| 58 | 3300042607 | Ga0466720_077910 | Ga0466720_077910_2042_2389 | 115 |
| 59 | 3300042607 | Ga0466720_087985 | Ga0466720_087985_559_906 | 115 |
| 60 | 3300042607 | Ga0466720_100380 | Ga0466720_100380_2465_2812 | 115 |
| 61 | 3300042607 | Ga0466720_130435 | Ga0466720_130435_173_520 | 115 |
| 62 | 3300042607 | Ga0466720_133113 | Ga0466720_133113_726_1073 | 115 |
| 63 | 3300042607 | Ga0466720_137966 | Ga0466720_137966_7243_7590 | 115 |
| 64 | 3300042607 | Ga0466720_155429 | Ga0466720_155429_263_610 | 115 |
| 65 | 3300042607 | Ga0466720_164975 | Ga0466720_164975_489_836 | 115 |
| 66 | 3300042607 | Ga0466720_176204 | Ga0466720_176204_677_1024 | 115 |
| 67 | 3300042607 | Ga0466720_180350 | Ga0466720_180350_436_783 | 115 |
| 68 | 3300042607 | Ga0466720_204925 | Ga0466720_204925_481_828 | 115 |
| 69 | 3300042607 | Ga0466720_216507 | Ga0466720_216507_268_615 | 115 |
| 70 | 3300042607 | Ga0466720_237064 | Ga0466720_237064_494_841 | 115 |
| 71 | 3300042608 | Ga0466721_248913 | Ga0466721_248913_1005_1352 | 115 |
| 72 | 3300042609 | Ga0466722_181494 | Ga0466722_181494_1148_1495 | 115 |
| 73 | 3300042610 | Ga0466698_036232 | Ga0466698_036232_238_585 | 115 |
| 74 | 3300042610 | Ga0466698_037464 | Ga0466698_037464_195_542 | 115 |
| 75 | 3300042610 | Ga0466698_057912 | Ga0466698_057912_454_801 | 115 |
| 76 | 3300042610 | Ga0466698_095125 | Ga0466698_095125_612_959 | 115 |
| 77 | 3300042610 | Ga0466698_141391 | Ga0466698_141391_61_408 | 115 |
| 78 | 3300042610 | Ga0466698_310768 | Ga0466698_310768_548_895 | 115 |
| 79 | 3300042611 | Ga0466697_216104 | Ga0466697_216104_613_960 | 115 |
| 80 | 3300042611 | Ga0466697_225533 | Ga0466697_225533_442_789 | 115 |
| 81 | 3300042613 | Ga0466710_456957 | Ga0466710_456957_694_1041 | 115 |
| 82 | 3300042616 | Ga0466715_159216 | Ga0466715_159216_1717_2064 | 115 |
| 83 | 3300042616 | Ga0466715_181802 | Ga0466715_181802_296_643 | 115 |
| 84 | 3300042616 | Ga0466715_301766 | Ga0466715_301766_1312_1659 | 115 |
| 85 | 3300042617 | Ga0466718_056663 | Ga0466718_056663_281_628 | 115 |
| 86 | 3300042617 | Ga0466718_073498 | Ga0466718_073498_586_933 | 115 |
| 87 | 3300042617 | Ga0466718_080504 | Ga0466718_080504_593_940 | 115 |
| 88 | 3300042617 | Ga0466718_084757 | Ga0466718_084757_523_870 | 115 |
| 89 | 3300042617 | Ga0466718_104733 | Ga0466718_104733_529_876 | 115 |
| 90 | 3300042617 | Ga0466718_128038 | Ga0466718_128038_495_842 | 115 |
| 91 | 3300042617 | Ga0466718_164547 | Ga0466718_164547_590_937 | 115 |
| 92 | 3300042618 | Ga0466723_314290 | Ga0466723_314290_3608_3955 | 115 |
| 93 | 3300042622 | Ga0466731_131607 | Ga0466731_131607_624_971 | 115 |
| 94 | 3300042622 | Ga0466731_207108 | Ga0466731_207108_497_844 | 115 |
| 95 | 3300042622 | Ga0466731_299480 | Ga0466731_299480_468_815 | 115 |
| 96 | 3300042623 | Ga0466734_136889 | Ga0466734_136889_740_1087 | 115 |
| 97 | 3300042623 | Ga0466734_172865 | Ga0466734_172865_338_685 | 115 |
| 98 | 3300042635 | Ga0466702_047072 | Ga0466702_047072_540_887 | 115 |
| 99 | 3300042635 | Ga0466702_055313 | Ga0466702_055313_229_576 | 115 |
| 100 | 3300042635 | Ga0466702_132471 | Ga0466702_132471_115_462 | 115 |
| 101 | 3300042635 | Ga0466702_194360 | Ga0466702_194360_124_471 | 115 |
| 102 | 3300042635 | Ga0466702_195892 | Ga0466702_195892_450_797 | 115 |
| 103 | 3300042635 | Ga0466702_197009 | Ga0466702_197009_94_441 | 115 |
| 104 | 3300042635 | Ga0466702_315843 | Ga0466702_315843_454_801 | 115 |
| 105 | 3300042635 | Ga0466702_354117 | Ga0466702_354117_1072_1419 | 115 |
| 106 | 3300042635 | Ga0466702_377929 | Ga0466702_377929_505_852 | 115 |
| 107 | 3300042635 | Ga0466702_417324 | Ga0466702_417324_1098_1445 | 115 |
| 108 | 3300042635 | Ga0466702_427902 | Ga0466702_427902_1118_1465 | 115 |
| 109 | 3300042635 | Ga0466702_433080 | Ga0466702_433080_938_1285 | 115 |
| 110 | 3300042636 | Ga0466703_331397 | Ga0466703_331397_562_909 | 115 |
| 111 | 3300042636 | Ga0466703_375789 | Ga0466703_375789_674_1021 | 115 |
| 112 | 3300042648 | Ga0466709_120463 | Ga0466709_120463_360_707 | 115 |
| 113 | 3300042648 | Ga0466709_363595 | Ga0466709_363595_1467_1814 | 115 |
| 114 | 3300042652 | Ga0466708_187955 | Ga0466708_187955_1400_1747 | 115 |
| 115 | 3300042656 | Ga0466732_008267 | Ga0466732_008267_253_600 | 115 |
| 116 | 3300042656 | Ga0466732_078175 | Ga0466732_078175_353_700 | 115 |
| 117 | 3300042656 | Ga0466732_159526 | Ga0466732_159526_479_826 | 115 |
| 118 | 3300042656 | Ga0466732_184089 | Ga0466732_184089_2458_2805 | 115 |
| 119 | 3300042656 | Ga0466732_346773 | Ga0466732_346773_1987_2334 | 115 |
| 120 | 3300000089 | AustNasuHG_c1004409 | AustNasuHG_10044092 | 116 |
| 121 | 3300000089 | AustNasuHG_c1005557 | AustNasuHG_10055574 | 116 |
| 122 | 3300000089 | AustNasuHG_c1006079 | AustNasuHG_10060793 | 116 |
| 123 | 3300000089 | AustNasuHG_c1013277 | AustNasuHG_10132773 | 116 |
| 124 | 3300000089 | AustNasuHG_c1015052 | AustNasuHG_10150523 | 116 |
| 125 | 3300000089 | AustNasuHG_c1017900 | AustNasuHG_10179002 | 116 |
| 126 | 3300000089 | AustNasuHG_c1019532 | AustNasuHG_10195322 | 116 |
| 127 | 3300000089 | AustNasuHG_c1021443 | AustNasuHG_10214432 | 116 |
| 128 | 3300000089 | AustNasuHG_c1025041 | AustNasuHG_10250412 | 116 |
| 129 | 3300000089 | AustNasuHG_c1034523 | AustNasuHG_10345232 | 116 |
| 130 | 3300000089 | AustNasuHG_c1036040 | AustNasuHG_10360402 | 116 |
| 131 | 3300000089 | AustNasuHG_c1036312 | AustNasuHG_10363122 | 116 |
| 132 | 3300000089 | AustNasuHG_c1038177 | AustNasuHG_10381772 | 116 |
| 133 | 3300000089 | AustNasuHG_c1041345 | AustNasuHG_10413452 | 116 |
| 134 | 3300000089 | AustNasuHG_c1045714 | AustNasuHG_10457142 | 116 |
| 135 | 3300000089 | AustNasuHG_c1046115 | AustNasuHG_10461152 | 116 |
| 136 | 3300000089 | AustNasuHG_c1047740 | AustNasuHG_10477402 | 116 |
| 137 | 3300000089 | AustNasuHG_c1049444 | AustNasuHG_10494442 | 116 |
| 138 | 3300000089 | AustNasuHG_c1054585 | AustNasuHG_10545852 | 116 |
| 139 | 3300000089 | AustNasuHG_c1058848 | AustNasuHG_10588482 | 116 |
| 140 | 3300000089 | AustNasuHG_c1072341 | AustNasuHG_10723412 | 116 |
| 141 | 3300001880 | FAAS_10003783 | FAAS_100037831 | 116 |
| 142 | 3300001880 | FAAS_10180402 | FAAS_101804022 | 116 |
| 143 | 3300002834 | JGI24696J40584_12808083 | JGI24696J40584_128080831 | 116 |
| 144 | 3300002834 | JGI24696J40584_12948593 | JGI24696J40584_129485932 | 116 |
| 145 | 3300005200 | Ga0072940_1028564 | Ga0072940_10285642 | 116 |
| 146 | 3300005485 | Ga0074263_104800 | Ga0074263_1048003 | 116 |
| 147 | 3300005485 | Ga0074263_107104 | Ga0074263_1071042 | 116 |
| 148 | 3300005485 | Ga0074263_109641 | Ga0074263_1096413 | 116 |
| 149 | 3300005485 | Ga0074263_110687 | Ga0074263_1106874 | 116 |
| 150 | 3300005485 | Ga0074263_111095 | Ga0074263_1110952 | 116 |
| 151 | 3300005485 | Ga0074263_113036 | Ga0074263_1130363 | 116 |
| 152 | 3300005485 | Ga0074263_117060 | Ga0074263_1170602 | 116 |
| 153 | 3300009784 | Ga0123357_10311101 | Ga0123357_103111012 | 116 |
| 154 | 3300009784 | Ga0123357_10780154 | Ga0123357_107801542 | 116 |
| 155 | 3300010049 | Ga0123356_13386646 | Ga0123356_133866462 | 116 |
| 156 | 3300042594 | Ga0466694_066776 | Ga0466694_066776_92_454 | 120 |
| 157 | 3300042605 | Ga0466716_412293 | Ga0466716_412293_16412_16774 | 120 |
| 158 | 3300042616 | Ga0466715_012650 | Ga0466715_012650_373_735 | 120 |
| 159 | 3300042656 | Ga0466732_206002 | Ga0466732_206002_487_849 | 120 |
| 160 | 3300000089 | AustNasuHG_c1043036 | AustNasuHG_10430362 | 121 |
| 161 | 3300010167 | Ga0123353_11419050 | Ga0123353_114190502 | 121 |
| 162 | 3300042607 | Ga0466720_009376 | Ga0466720_009376_270_635 | 121 |
| 163 | 3300042607 | Ga0466720_055515 | Ga0466720_055515_14344_14709 | 121 |
| 164 | 3300042607 | Ga0466720_103107 | Ga0466720_103107_827_1192 | 121 |
| 165 | 3300042623 | Ga0466734_169737 | Ga0466734_169737_400_765 | 121 |
| 166 | 3300000089 | AustNasuHG_c1040349 | AustNasuHG_10403492 | 122 |
| 167 | 3300005485 | Ga0074263_112660 | Ga0074263_1126604 | 122 |
| 168 | 2030936001 | Nasutiter_Contig04437 | Nasutiterm_1380600 | 133 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05717 | TnpB_IS66 | IS66 Orf2 like protein | 9 | 110 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.48 | 0.51 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.