Protein Family IF06403
Metagenome
Isolate
125
Members
36
Samples
120
Scaffolds
451.25
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_381443|Ga0466716_381443_1205_2716
- Length
- 503 aa
- Sequence
- MGSDFFFRAARQCRMQAGLPCAAGRTAGRDGGGVMNGMKNKGPGNADSGDPRLEQPAPAALYYKTILRLALPIGLQNLIGFAVNFADNIMVGRLGDLAIAGVFIGNQIHSMVMFITSGIGATLVILATQYWGKKDIRSIRSLTAISLWVSLGAGAVFTILTAVFPGFIAGLLSNKEDVILSSVPYLRFIGLSFVFFTVSQVLVASQRSVEKVRFGMNIALITLVFNVGLNYCLIFGRLGFPALGVQGAALATLISRILECIVAACYVFGIDKRIALRLRDLGKLDKFLCFSLLKYGAPVVAGDIVWAANSFAYTAIVGRFTADIIASFNIAGMMNTMVYIWMSGLAAALGIMTGKLVGGGAPVAAIKAHSYRTQRFFPLVGLATGLFVFFFKGVLISFYNISPEAALAAPQLLNVLALTIVGTAYQMPGLGGLVKAGGNISFVFRNDFIFVFFVVIPSSIIAMLLKAPAWVVFLCLKCDQILKCFVALVVINRFRWIKDLTRG
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.9%
Termitidae
30.6%
Unclassified
13.9%
Rhinotermitidae
5.6%
Passalidae
5.6%
Termopsidae
5.6%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 32 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466696_142716 | 3300042596 | Bacteria | 15106 |
| 2 | Ga0466703_273540 | 3300042636 | Bacteria | 18168 |
| 3 | Ga0466703_333038 | 3300042636 | Bacteria | 2528 |
| 4 | Ga0466704_151402 | 3300042643 | Bacteria | 3493 |
| 5 | Ga0466719_036149 | 3300042606 | Bacteria | 9087 |
| 6 | Ga0466721_341014 | 3300042608 | Bacteria | 2870 |
| 7 | Ga0466722_126821 | 3300042609 | Bacteria | 1901 |
| 8 | Ga0466722_244561 | 3300042609 | Bacteria | 3164 |
| 9 | Ga0123357_10269364 | 3300009784 | Bacteria | 1783 |
| 10 | Ga0123356_10000028 | 3300010049 | Bacteria | 164875 |
| 11 | Ga0123356_10056776 | 3300010049 | Bacteria | 3648 |
| 12 | Ga0123356_10092050 | 3300010049 | Unclassified | 2891 |
| 13 | Ga0466715_311690 | 3300042616 | Bacteria | 7893 |
| 14 | Ga0466726_115044 | 3300042619 | Bacteria | 1546 |
| 15 | Ga0466705_062840 | 3300042612 | Bacteria | 11498 |
| 16 | Ga0466705_093770 | 3300042612 | Bacteria | 7062 |
| 17 | Ga0466690_075308 | 3300042590 | Bacteria | 6287 |
| 18 | Ga0466691_213540 | 3300042593 | Bacteria | 2959 |
| 19 | Ga0466696_460146 | 3300042596 | Bacteria | 25654 |
| 20 | Ga0466708_249108 | 3300042652 | Bacteria | 5923 |
| 21 | Ga0123356_10015129 | 3300010049 | Bacteria | 7399 |
| 22 | Ga0123353_10006657 | 3300010167 | Bacteria | 15443 |
| 23 | Ga0123353_10237551 | 3300010167 | Bacteria | 2835 |
| 24 | Ga0466705_521189 | 3300042612 | Bacteria | 9208 |
| 25 | Ga0466715_148279 | 3300042616 | Bacteria | 16154 |
| 26 | Ga0466715_269810 | 3300042616 | Bacteria | 39825 |
| 27 | Ga0466723_169571 | 3300042618 | Bacteria | 27673 |
| 28 | Ga0466723_232345 | 3300042618 | Bacteria | 8684 |
| 29 | Ga0415639_004452 | 3300038395 | Bacteria | 2406 |
| 30 | Ga0466691_103015 | 3300042593 | Bacteria | 4449 |
| 31 | Ga0466696_312523 | 3300042596 | Bacteria | 4580 |
| 32 | JGI24698J34947_10002139 | 3300002449 | Bacteria | 10581 |
| 33 | Ga0466702_376825 | 3300042635 | Unclassified | 2838 |
| 34 | Ga0466703_308219 | 3300042636 | Bacteria | 16421 |
| 35 | Ga0466704_262051 | 3300042643 | Bacteria | 4877 |
| 36 | Ga0466709_322174 | 3300042648 | Bacteria | 2821 |
| 37 | Ga0466708_176007 | 3300042652 | Bacteria | 3458 |
| 38 | Ga0466719_191387 | 3300042606 | Bacteria | 2786 |
| 39 | Ga0466712_197350 | 3300042614 | Bacteria | 26294 |
| 40 | Ga0466715_356842 | 3300042616 | Bacteria | 1925 |
| 41 | Ga0466728_008499 | 3300042620 | Bacteria | 3862 |
| 42 | Ga0466705_206545 | 3300042612 | Bacteria | 3047 |
| 43 | Ga0466692_000687 | 3300042591 | Bacteria | 14267 |
| 44 | Ga0466691_060605 | 3300042593 | Bacteria | 14254 |
| 45 | Ga0466702_323410 | 3300042635 | Bacteria | 53168 |
| 46 | Ga0466709_135424 | 3300042648 | Bacteria | 3829 |
| 47 | Ga0466709_193882 | 3300042648 | Bacteria | 5793 |
| 48 | Ga0466708_464475 | 3300042652 | Bacteria | 69222 |
| 49 | Ga0466722_029429 | 3300042609 | Bacteria | 3091 |
| 50 | Ga0123356_10022412 | 3300010049 | Bacteria | 5964 |
| 51 | Ga0466705_506313 | 3300042612 | Unclassified | 4818 |
| 52 | Ga0466696_223433 | 3300042596 | Bacteria | 1961 |
| 53 | Ga0466696_471025 | 3300042596 | Bacteria | 11169 |
| 54 | Ga0466703_205642 | 3300042636 | Bacteria | 23905 |
| 55 | Ga0466708_226005 | 3300042652 | Bacteria | 2871 |
| 56 | Ga0466727_333677 | 3300042655 | Bacteria | 1354 |
| 57 | Ga0466719_103798 | 3300042606 | Bacteria | 10547 |
| 58 | Ga0466721_281777 | 3300042608 | Bacteria | 11632 |
| 59 | Ga0466722_152337 | 3300042609 | Bacteria | 12751 |
| 60 | Ga0123356_10000033 | 3300010049 | Bacteria | 152581 |
| 61 | Ga0466712_028857 | 3300042614 | Bacteria | 2069 |
| 62 | Ga0466715_012720 | 3300042616 | Bacteria | 11389 |
| 63 | Ga0466715_131374 | 3300042616 | Bacteria | 15464 |
| 64 | Ga0466723_263933 | 3300042618 | Bacteria | 4882 |
| 65 | Ga0466726_175894 | 3300042619 | Bacteria | 1504 |
| 66 | Ga0466726_326088 | 3300042619 | Bacteria | 2055 |
| 67 | Ga0466726_433148 | 3300042619 | Bacteria | 2980 |
| 68 | Ga0466705_101894 | 3300042612 | Bacteria | 11632 |
| 69 | Ga0466705_110649 | 3300042612 | Unclassified | 2004 |
| 70 | Ga0466705_146538 | 3300042612 | Bacteria | 158344 |
| 71 | Ga0466691_193262 | 3300042593 | Bacteria | 2423 |
| 72 | Ga0466694_145587 | 3300042594 | Bacteria | 5739 |
| 73 | Ga0466696_325304 | 3300042596 | Bacteria | 9476 |
| 74 | Ga0466702_065319 | 3300042635 | Bacteria | 12834 |
| 75 | Ga0466702_370910 | 3300042635 | Bacteria | 2130 |
| 76 | Ga0466703_001989 | 3300042636 | Bacteria | 25288 |
| 77 | Ga0466704_514806 | 3300042643 | Unclassified | 4718 |
| 78 | Ga0466727_233039 | 3300042655 | Bacteria | 9959 |
| 79 | Ga0466716_188061 | 3300042605 | Bacteria | 1574 |
| 80 | Ga0466722_036523 | 3300042609 | Bacteria | 6447 |
| 81 | Ga0123356_10016042 | 3300010049 | Bacteria | 7160 |
| 82 | Ga0123356_10129752 | 3300010049 | Unclassified | 2467 |
| 83 | Ga0466712_089040 | 3300042614 | Bacteria | 4550 |
| 84 | Ga0466728_198151 | 3300042620 | Bacteria | 4775 |
| 85 | Ga0466690_111986 | 3300042590 | Bacteria | 3098 |
| 86 | Ga0466696_442695 | 3300042596 | Bacteria | 6430 |
| 87 | 2227655188 | 2225789004 | Bacteria | 10624 |
| 88 | JGI24698J34947_10002096 | 3300002449 | Bacteria | 10663 |
| 89 | Ga0466703_275780 | 3300042636 | Bacteria | 5623 |
| 90 | Ga0466704_064229 | 3300042643 | Bacteria | 7871 |
| 91 | Ga0466704_149454 | 3300042643 | Bacteria | 2104 |
| 92 | Ga0466709_315407 | 3300042648 | Bacteria | 3428 |
| 93 | Ga0466708_148286 | 3300042652 | Bacteria | 7562 |
| 94 | Ga0466727_018297 | 3300042655 | Bacteria | 2457 |
| 95 | Ga0466727_336564 | 3300042655 | Bacteria | 5029 |
| 96 | Ga0466711_175339 | 3300042615 | Bacteria | 20337 |
| 97 | Ga0466711_239098 | 3300042615 | Bacteria | 5865 |
| 98 | Ga0466715_195197 | 3300042616 | Bacteria | 5049 |
| 99 | Ga0466705_263550 | 3300042612 | Bacteria | 16833 |
| 100 | Ga0466696_245965 | 3300042596 | Bacteria | 17616 |
| 101 | IMNBL1DRAFT_c0000003 | 3300000062 | Bacteria | 275310 |
| 102 | Ga0466703_046284 | 3300042636 | Bacteria | 2942 |
| 103 | Ga0466703_073029 | 3300042636 | Bacteria | 8625 |
| 104 | Ga0466703_203386 | 3300042636 | Bacteria | 2180 |
| 105 | Ga0466703_225867 | 3300042636 | Bacteria | 6243 |
| 106 | Ga0466703_259242 | 3300042636 | Bacteria | 6759 |
| 107 | Ga0466703_304616 | 3300042636 | Bacteria | 21418 |
| 108 | Ga0466704_606958 | 3300042643 | Bacteria | 82552 |
| 109 | Ga0466709_067001 | 3300042648 | Bacteria | 7292 |
| 110 | Ga0466701_101855 | 3300042598 | Bacteria | 136142 |
| 111 | Ga0466716_230901 | 3300042605 | Bacteria | 6751 |
| 112 | Ga0466716_381443 | 3300042605 | Bacteria | 5985 |
| 113 | Ga0466716_468531 | 3300042605 | Bacteria | 3706 |
| 114 | Ga0123355_10229747 | 3300009826 | Bacteria | 2651 |
| 115 | Ga0123353_10289103 | 3300010167 | Bacteria | 2511 |
| 116 | Ga0466705_520468 | 3300042612 | Bacteria | 7983 |
| 117 | Ga0466726_012091 | 3300042619 | Bacteria | 3606 |
| 118 | Ga0466726_300535 | 3300042619 | Bacteria | 2743 |
| 119 | Ga0466726_449292 | 3300042619 | Bacteria | 9398 |
| 120 | Ga0466728_330545 | 3300042620 | Bacteria | 1735 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.