Protein Family IF06389
Metagenome
Isolate
210
Members
44
Samples
205
Scaffolds
325.99
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_309900|Ga0466716_309900_3156_4217
- Length
- 304 aa
- Sequence
- MLSNGVTQNIRGFIAGFGWPRLILIAPFVGVLVASSLKDVIVRFGQNGIMVLAMVPMMQAGTGLNFLTGAFGFFAAKVKGEEMTIAMYVGFSIVTFMAIMWLILPYRNPTMVWGYQGTGLRTTISMEGYWSHILNNFLVIKIGKNFEFPTGSILFFVLMAFFMWLFMRSRTGTALTSAGSNPIFARAGGVSIDKMRLISVTISTVYGAIGILVFQQSFGFVQLYQAPLYMAFPAVAAILLGGASINKASILNVVVGTFLFQSILTMTPAVINSVLKTDMSEVIRILISNGMIIYALTRKTQGAK
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.9%
Kalotermitidae
32.6%
Unclassified
11.6%
Rhinotermitidae
9.3%
Termopsidae
7.0%
Blaberidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 10 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 15 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_223672 | 3300042612 | Bacteria | 1734 |
| 2 | Ga0466705_342283 | 3300042612 | Bacteria | 4796 |
| 3 | Ga0466705_366129 | 3300042612 | Bacteria | 3582 |
| 4 | Ga0466729_201357 | 3300042621 | Bacteria | 1765 |
| 5 | Ga0466729_301767 | 3300042621 | Bacteria | 1472 |
| 6 | Ga0466703_034327 | 3300042636 | Bacteria | 6856 |
| 7 | Ga0466727_190222 | 3300042655 | Bacteria | 1947 |
| 8 | Ga0466712_023838 | 3300042614 | Bacteria | 27673 |
| 9 | Ga0466712_069675 | 3300042614 | Unclassified | 2072 |
| 10 | Ga0466712_229419 | 3300042614 | Unclassified | 1556 |
| 11 | Ga0466711_047053 | 3300042615 | Bacteria | 30744 |
| 12 | Ga0466711_251557 | 3300042615 | Bacteria | 7097 |
| 13 | Ga0466711_434693 | 3300042615 | Unclassified | 2565 |
| 14 | Ga0466715_001364 | 3300042616 | Bacteria | 11977 |
| 15 | Ga0123353_10006277 | 3300010167 | Bacteria | 15798 |
| 16 | Ga0466690_231206 | 3300042590 | Bacteria | 4925 |
| 17 | Ga0466690_301128 | 3300042590 | Bacteria | 14656 |
| 18 | Ga0466690_348873 | 3300042590 | Bacteria | 2414 |
| 19 | Ga0466692_063053 | 3300042591 | Bacteria | 5739 |
| 20 | Ga0466692_100837 | 3300042591 | Unclassified | 10351 |
| 21 | Ga0466691_164175 | 3300042593 | Unclassified | 8423 |
| 22 | Ga0466691_172104 | 3300042593 | Bacteria | 8819 |
| 23 | Ga0466699_352974 | 3300042597 | Unclassified | 1647 |
| 24 | Ga0466706_234670 | 3300042599 | Bacteria | 2124 |
| 25 | Ga0466707_380115 | 3300042601 | Unclassified | 2223 |
| 26 | Ga0466716_245286 | 3300042605 | Bacteria | 4293 |
| 27 | Ga0466716_357668 | 3300042605 | Bacteria | 3732 |
| 28 | Ga0466722_160996 | 3300042609 | Bacteria | 18974 |
| 29 | Ga0466705_251698 | 3300042612 | Bacteria | 2696 |
| 30 | JGI24702J35022_10049720 | 3300002462 | Bacteria | 2233 |
| 31 | Ga0068302_10007050 | 3300005071 | Bacteria | 2902 |
| 32 | Ga0072941_1022678 | 3300005201 | Bacteria | 9551 |
| 33 | Ga0466703_050312 | 3300042636 | Bacteria | 5784 |
| 34 | Ga0466703_238470 | 3300042636 | Bacteria | 2053 |
| 35 | Ga0466704_108428 | 3300042643 | Bacteria | 12073 |
| 36 | Ga0466704_400117 | 3300042643 | Bacteria | 4233 |
| 37 | Ga0466709_351522 | 3300042648 | Bacteria | 13513 |
| 38 | Ga0466708_035859 | 3300042652 | Bacteria | 41234 |
| 39 | Ga0466708_167277 | 3300042652 | Bacteria | 2053 |
| 40 | Ga0466708_184900 | 3300042652 | Bacteria | 8250 |
| 41 | Ga0466712_025557 | 3300042614 | Bacteria | 17046 |
| 42 | Ga0123353_10233587 | 3300010167 | Bacteria | 2864 |
| 43 | Ga0466691_025724 | 3300042593 | Bacteria | 8952 |
| 44 | Ga0466691_117882 | 3300042593 | Bacteria | 10489 |
| 45 | Ga0466691_160942 | 3300042593 | Bacteria | 4828 |
| 46 | Ga0466694_298657 | 3300042594 | Bacteria | 3863 |
| 47 | Ga0466694_298861 | 3300042594 | Bacteria | 3938 |
| 48 | Ga0466696_294198 | 3300042596 | Bacteria | 9197 |
| 49 | Ga0466699_227803 | 3300042597 | Bacteria | 20734 |
| 50 | Ga0466706_180613 | 3300042599 | Bacteria | 2216 |
| 51 | Ga0466707_155301 | 3300042601 | Bacteria | 1360 |
| 52 | Ga0466716_124843 | 3300042605 | Bacteria | 14158 |
| 53 | Ga0466716_129539 | 3300042605 | Bacteria | 7144 |
| 54 | Ga0466716_188283 | 3300042605 | Bacteria | 3770 |
| 55 | Ga0466719_331422 | 3300042606 | Bacteria | 3722 |
| 56 | Ga0466722_015506 | 3300042609 | Bacteria | 2010 |
| 57 | Ga0466722_080187 | 3300042609 | Bacteria | 9094 |
| 58 | Ga0466705_053740 | 3300042612 | Bacteria | 6375 |
| 59 | Ga0466705_343591 | 3300042612 | Bacteria | 7988 |
| 60 | AustNasuHG_c1000250 | 3300000089 | Bacteria | 18173 |
| 61 | Ga0466703_142695 | 3300042636 | Bacteria | 5432 |
| 62 | Ga0466703_177637 | 3300042636 | Bacteria | 197398 |
| 63 | Ga0466704_092724 | 3300042643 | Bacteria | 21710 |
| 64 | Ga0466704_120815 | 3300042643 | Bacteria | 4195 |
| 65 | Ga0466704_267557 | 3300042643 | Bacteria | 5612 |
| 66 | Ga0466709_036298 | 3300042648 | Bacteria | 2544 |
| 67 | Ga0466709_244428 | 3300042648 | Bacteria | 5458 |
| 68 | Ga0466708_067510 | 3300042652 | Bacteria | 3191 |
| 69 | Ga0466708_069512 | 3300042652 | Bacteria | 3986 |
| 70 | Ga0466712_063934 | 3300042614 | Bacteria | 13931 |
| 71 | Ga0466726_090244 | 3300042619 | Bacteria | 1504 |
| 72 | Ga0466696_094609 | 3300042596 | Unclassified | 1628 |
| 73 | Ga0466699_185193 | 3300042597 | Bacteria | 2762 |
| 74 | Ga0466707_005687 | 3300042601 | Bacteria | 2791 |
| 75 | Ga0466714_068416 | 3300042603 | Bacteria | 4263 |
| 76 | Ga0466716_134351 | 3300042605 | Bacteria | 9093 |
| 77 | Ga0466719_028622 | 3300042606 | Bacteria | 29457 |
| 78 | Ga0466722_196308 | 3300042609 | Bacteria | 30459 |
| 79 | Ga0466698_242303 | 3300042610 | Bacteria | 1540 |
| 80 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 81 | Ga0466733_141574 | 3300042659 | Bacteria | 39609 |
| 82 | JGI24698J34947_10011874 | 3300002449 | Unclassified | 4782 |
| 83 | Ga0466729_250848 | 3300042621 | Bacteria | 7728 |
| 84 | Ga0466703_018141 | 3300042636 | Bacteria | 5454 |
| 85 | Ga0466703_293984 | 3300042636 | Bacteria | 3107 |
| 86 | Ga0466704_012134 | 3300042643 | Bacteria | 32013 |
| 87 | Ga0466709_226962 | 3300042648 | Unclassified | 10600 |
| 88 | Ga0466708_062043 | 3300042652 | Bacteria | 7554 |
| 89 | Ga0466708_309686 | 3300042652 | Bacteria | 19106 |
| 90 | Ga0466712_178679 | 3300042614 | Bacteria | 10236 |
| 91 | Ga0466711_194109 | 3300042615 | Bacteria | 7522 |
| 92 | Ga0466711_364659 | 3300042615 | Bacteria | 14297 |
| 93 | Ga0466715_072961 | 3300042616 | Bacteria | 6397 |
| 94 | Ga0466715_152458 | 3300042616 | Unclassified | 4674 |
| 95 | Ga0466715_259750 | 3300042616 | Bacteria | 18031 |
| 96 | Ga0466723_004479 | 3300042618 | Bacteria | 9421 |
| 97 | Ga0466723_260258 | 3300042618 | Bacteria | 6172 |
| 98 | Ga0466726_044422 | 3300042619 | Bacteria | 32261 |
| 99 | Ga0466726_050726 | 3300042619 | Bacteria | 6913 |
| 100 | Ga0466728_117170 | 3300042620 | Unclassified | 3788 |
| 101 | Ga0466728_380881 | 3300042620 | Bacteria | 39953 |
| 102 | Ga0123353_10248124 | 3300010167 | Bacteria | 2760 |
| 103 | Ga0466690_258633 | 3300042590 | Bacteria | 1224 |
| 104 | Ga0466690_309222 | 3300042590 | Unclassified | 2189 |
| 105 | Ga0466692_020374 | 3300042591 | Bacteria | 1683 |
| 106 | Ga0466694_162279 | 3300042594 | Bacteria | 4824 |
| 107 | Ga0466699_271872 | 3300042597 | Bacteria | 1386 |
| 108 | Ga0466716_408761 | 3300042605 | Bacteria | 2944 |
| 109 | Ga0466719_016333 | 3300042606 | Bacteria | 1601 |
| 110 | Ga0466719_090845 | 3300042606 | Bacteria | 3622 |
| 111 | Ga0466705_113877 | 3300042612 | Bacteria | 2484 |
| 112 | Ga0466705_208204 | 3300042612 | Bacteria | 12378 |
| 113 | JGI24698J34947_10000877 | 3300002449 | Bacteria | 15197 |
| 114 | JGI24702J35022_10001174 | 3300002462 | Bacteria | 16292 |
| 115 | Ga0466703_131946 | 3300042636 | Bacteria | 2529 |
| 116 | Ga0466704_242874 | 3300042643 | Bacteria | 2493 |
| 117 | Ga0466704_289449 | 3300042643 | Bacteria | 13176 |
| 118 | Ga0466704_290161 | 3300042643 | Bacteria | 2492 |
| 119 | Ga0466709_064903 | 3300042648 | Bacteria | 14125 |
| 120 | Ga0466709_420478 | 3300042648 | Bacteria | 3781 |
| 121 | Ga0466711_327894 | 3300042615 | Bacteria | 4790 |
| 122 | Ga0466715_101265 | 3300042616 | Bacteria | 4189 |
| 123 | Ga0466715_205101 | 3300042616 | Bacteria | 12493 |
| 124 | Ga0466715_466256 | 3300042616 | Bacteria | 4620 |
| 125 | Ga0466726_434315 | 3300042619 | Bacteria | 5925 |
| 126 | Ga0466728_064632 | 3300042620 | Unclassified | 6286 |
| 127 | Ga0466728_337027 | 3300042620 | Unclassified | 4473 |
| 128 | Ga0466691_090347 | 3300042593 | Bacteria | 10907 |
| 129 | Ga0466696_004446 | 3300042596 | Bacteria | 5807 |
| 130 | Ga0466716_012382 | 3300042605 | Bacteria | 4191 |
| 131 | Ga0466716_309900 | 3300042605 | Bacteria | 5759 |
| 132 | Ga0466722_183638 | 3300042609 | Bacteria | 13507 |
| 133 | Ga0466733_081493 | 3300042659 | Bacteria | 4042 |
| 134 | JGI24698J34947_10014591 | 3300002449 | Bacteria | 4279 |
| 135 | JGI24702J35022_10007047 | 3300002462 | Bacteria | 6457 |
| 136 | Ga0466709_240212 | 3300042648 | Bacteria | 5619 |
| 137 | Ga0466708_061435 | 3300042652 | Bacteria | 15050 |
| 138 | Ga0466708_340818 | 3300042652 | Bacteria | 4638 |
| 139 | Ga0466712_038920 | 3300042614 | Unclassified | 2786 |
| 140 | Ga0466715_458842 | 3300042616 | Bacteria | 4980 |
| 141 | Ga0466715_477282 | 3300042616 | Unclassified | 1899 |
| 142 | Ga0466723_117033 | 3300042618 | Unclassified | 2334 |
| 143 | Ga0466723_145478 | 3300042618 | Bacteria | 8940 |
| 144 | Ga0466723_311378 | 3300042618 | Bacteria | 14066 |
| 145 | Ga0466726_163370 | 3300042619 | Unclassified | 1074 |
| 146 | Ga0466728_161663 | 3300042620 | Bacteria | 6025 |
| 147 | Ga0123353_10100971 | 3300010167 | Bacteria | 4651 |
| 148 | Ga0123353_10496808 | 3300010167 | Bacteria | 1779 |
| 149 | Ga0466690_078130 | 3300042590 | Unclassified | 2846 |
| 150 | Ga0466691_167206 | 3300042593 | Bacteria | 9092 |
| 151 | Ga0466694_174557 | 3300042594 | Bacteria | 3240 |
| 152 | Ga0466696_081603 | 3300042596 | Bacteria | 18095 |
| 153 | Ga0466696_371476 | 3300042596 | Bacteria | 6887 |
| 154 | Ga0466699_202323 | 3300042597 | Unclassified | 1766 |
| 155 | Ga0466716_094917 | 3300042605 | Bacteria | 4180 |
| 156 | Ga0466719_104758 | 3300042606 | Bacteria | 3502 |
| 157 | Ga0466719_225373 | 3300042606 | Bacteria | 49819 |
| 158 | Ga0466705_042615 | 3300042612 | Bacteria | 1792 |
| 159 | Ga0466705_226278 | 3300042612 | Bacteria | 5584 |
| 160 | JGI24698J34947_10012220 | 3300002449 | Bacteria | 4709 |
| 161 | Ga0072940_1033817 | 3300005200 | Bacteria | 3308 |
| 162 | Ga0072941_1049880 | 3300005201 | Bacteria | 7994 |
| 163 | Ga0466703_170366 | 3300042636 | Unclassified | 1373 |
| 164 | Ga0466704_118851 | 3300042643 | Bacteria | 6564 |
| 165 | Ga0466709_279463 | 3300042648 | Bacteria | 6581 |
| 166 | Ga0466708_359482 | 3300042652 | Unclassified | 3815 |
| 167 | Ga0466711_276484 | 3300042615 | Bacteria | 13022 |
| 168 | Ga0466711_277171 | 3300042615 | Bacteria | 12165 |
| 169 | Ga0466715_138252 | 3300042616 | Bacteria | 14142 |
| 170 | Ga0466723_005097 | 3300042618 | Bacteria | 11859 |
| 171 | Ga0466723_057924 | 3300042618 | Bacteria | 13629 |
| 172 | Ga0123357_10219296 | 3300009784 | Bacteria | 2115 |
| 173 | Ga0123353_10561409 | 3300010167 | Bacteria | 1643 |
| 174 | Ga0466690_227917 | 3300042590 | Unclassified | 6111 |
| 175 | Ga0466692_144954 | 3300042591 | Bacteria | 19772 |
| 176 | Ga0466691_037708 | 3300042593 | Bacteria | 9878 |
| 177 | Ga0466696_130083 | 3300042596 | Bacteria | 16017 |
| 178 | Ga0466696_143706 | 3300042596 | Bacteria | 5421 |
| 179 | Ga0466707_413091 | 3300042601 | Bacteria | 1824 |
| 180 | Ga0466714_156182 | 3300042603 | Bacteria | 4599 |
| 181 | Ga0466719_291459 | 3300042606 | Bacteria | 2274 |
| 182 | Ga0466720_218348 | 3300042607 | Bacteria | 1521 |
| 183 | Ga0466705_150491 | 3300042612 | Bacteria | 6695 |
| 184 | Ga0466733_072934 | 3300042659 | Bacteria | 22175 |
| 185 | JGI24698J34947_10012898 | 3300002449 | Bacteria | 4566 |
| 186 | JGI24697J35500_11233691 | 3300002507 | Bacteria | 2083 |
| 187 | Ga0466709_197423 | 3300042648 | Unclassified | 3679 |
| 188 | Ga0466708_136976 | 3300042652 | Unclassified | 2792 |
| 189 | Ga0466708_154833 | 3300042652 | Unclassified | 4685 |
| 190 | Ga0466715_077393 | 3300042616 | Bacteria | 22122 |
| 191 | Ga0466718_019533 | 3300042617 | Bacteria | 16064 |
| 192 | Ga0466723_089476 | 3300042618 | Bacteria | 4862 |
| 193 | Ga0466723_352563 | 3300042618 | Bacteria | 4918 |
| 194 | Ga0466728_048045 | 3300042620 | Bacteria | 4155 |
| 195 | Ga0456237_0002700 | 3300041968 | Bacteria | 2864 |
| 196 | Ga0466690_047832 | 3300042590 | Bacteria | 3843 |
| 197 | Ga0466690_240921 | 3300042590 | Unclassified | 3117 |
| 198 | Ga0466690_284118 | 3300042590 | Unclassified | 5034 |
| 199 | Ga0466692_012890 | 3300042591 | Bacteria | 2940 |
| 200 | Ga0466691_104204 | 3300042593 | Bacteria | 18796 |
| 201 | Ga0466706_051071 | 3300042599 | Bacteria | 5627 |
| 202 | Ga0466716_261756 | 3300042605 | Unclassified | 5824 |
| 203 | Ga0466716_344298 | 3300042605 | Bacteria | 3546 |
| 204 | Ga0466719_091801 | 3300042606 | Bacteria | 4314 |
| 205 | Ga0466722_108500 | 3300042609 | Bacteria | 4661 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 26 | 286 | 0.7 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.