Protein Family IF06380
Metagenome
Metatranscriptome
Isolate
179
Members
52
Samples
175
Scaffolds
244.94
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_255639|Ga0466716_255639_762_1595
- Length
- 277 aa
- Sequence
- MEKIRNGGGNSGMIYLTGFHAIEEYLKSGRPCGPLLAAKPGPRSRELVSLAAERRVRVDRVGTHDLDRIAPDHRGVALELEAPAGAGNADTGLEEFIAGLKGRGEEAGGAGERKEALVLILDEITDPHNYGAILRSCDQFGVYLVLSRNRRSAKHAAVIAQTSAGASAWVPQAETANLPRAAETLKEAGFWIYGADMAGEAAGRIDLRGRIALVLGGEGTGISRLLRERCDGLIAVPSRGRIDSLNVSVAAGVLMYEAMRQRAGGDGTGDTLSSAKG
Sample Types
Isolate
2.2%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.0%
Kalotermitidae
28.0%
Unclassified
14.0%
Rhinotermitidae
6.0%
Termopsidae
4.0%
Taxonomy
Archaea
2
Bacteria
172
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 30 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_326158 | 3300042612 | Bacteria | 12012 |
| 2 | Ga0123356_10630897 | 3300010049 | Bacteria | 1238 |
| 3 | Ga0123353_10489058 | 3300010167 | Bacteria | 1797 |
| 4 | Ga0466712_115862 | 3300042614 | Bacteria | 12334 |
| 5 | Ga0466715_302972 | 3300042616 | Bacteria | 3397 |
| 6 | Ga0466718_064260 | 3300042617 | Archaea | 4844 |
| 7 | Ga0466723_322355 | 3300042618 | Bacteria | 5800 |
| 8 | Ga0466723_328822 | 3300042618 | Bacteria | 4934 |
| 9 | AustNasuHG_c1000154 | 3300000089 | Bacteria | 21784 |
| 10 | JGI24696J40584_12875166 | 3300002834 | Bacteria | 1061 |
| 11 | Ga0068305_10021267 | 3300005083 | Bacteria | 8383 |
| 12 | Ga0072940_1051122 | 3300005200 | Bacteria | 2494 |
| 13 | Ga0466707_228326 | 3300042601 | Bacteria | 1850 |
| 14 | Ga0466707_394568 | 3300042601 | Bacteria | 1183 |
| 15 | Ga0466716_200181 | 3300042605 | Bacteria | 3330 |
| 16 | Ga0466735_032547 | 3300042624 | Bacteria | 7467 |
| 17 | Ga0466735_166857 | 3300042624 | Bacteria | 1059 |
| 18 | Ga0466735_182427 | 3300042624 | Bacteria | 6990 |
| 19 | Ga0466702_087086 | 3300042635 | Bacteria | 1165 |
| 20 | Ga0466703_062837 | 3300042636 | Unclassified | 1894 |
| 21 | Ga0466709_036849 | 3300042648 | Bacteria | 4005 |
| 22 | Ga0466708_215068 | 3300042652 | Bacteria | 1986 |
| 23 | Ga0466694_017392 | 3300042594 | Bacteria | 6285 |
| 24 | Ga0466694_284352 | 3300042594 | Bacteria | 1719 |
| 25 | Ga0466696_108645 | 3300042596 | Bacteria | 3065 |
| 26 | Ga0123357_10616298 | 3300009784 | Bacteria | 823 |
| 27 | Ga0466705_516768 | 3300042612 | Bacteria | 1303 |
| 28 | Ga0466715_546326 | 3300042616 | Bacteria | 1342 |
| 29 | JGI24698J34947_10012133 | 3300002449 | Bacteria | 4729 |
| 30 | JGI24702J35022_10002568 | 3300002462 | Bacteria | 11037 |
| 31 | Ga0074263_111605 | 3300005485 | Bacteria | 863 |
| 32 | Ga0466707_087515 | 3300042601 | Bacteria | 1045 |
| 33 | Ga0466707_372522 | 3300042601 | Bacteria | 1086 |
| 34 | Ga0466713_024135 | 3300042602 | Bacteria | 2314 |
| 35 | Ga0466716_098923 | 3300042605 | Bacteria | 15103 |
| 36 | Ga0466716_255639 | 3300042605 | Bacteria | 2135 |
| 37 | Ga0466722_065702 | 3300042609 | Bacteria | 13369 |
| 38 | Ga0466734_043403 | 3300042623 | Bacteria | 1398 |
| 39 | Ga0466703_064996 | 3300042636 | Bacteria | 8023 |
| 40 | Ga0466709_082932 | 3300042648 | Bacteria | 2151 |
| 41 | Ga0466709_304692 | 3300042648 | Bacteria | 2422 |
| 42 | Ga0466708_211670 | 3300042652 | Bacteria | 11257 |
| 43 | Ga0466691_169923 | 3300042593 | Bacteria | 3008 |
| 44 | Ga0466694_138924 | 3300042594 | Bacteria | 3789 |
| 45 | Ga0466694_278410 | 3300042594 | Bacteria | 2614 |
| 46 | Ga0123353_10695837 | 3300010167 | Bacteria | 1428 |
| 47 | Ga0466712_081357 | 3300042614 | Bacteria | 8131 |
| 48 | Ga0466711_383554 | 3300042615 | Bacteria | 20506 |
| 49 | Ga0466711_484750 | 3300042615 | Bacteria | 31730 |
| 50 | Ga0466728_224239 | 3300042620 | Bacteria | 4087 |
| 51 | Ga0466728_246642 | 3300042620 | Bacteria | 4654 |
| 52 | JGI24695J34938_10007474 | 3300002450 | Bacteria | 6392 |
| 53 | JGI24702J35022_10001861 | 3300002462 | Bacteria | 12986 |
| 54 | Ga0466700_000053 | 3300042600 | Bacteria | 1396 |
| 55 | Ga0466707_348552 | 3300042601 | Bacteria | 1265 |
| 56 | Ga0466719_490884 | 3300042606 | Unclassified | 4315 |
| 57 | Ga0466720_168950 | 3300042607 | Bacteria | 2599 |
| 58 | Ga0466722_182601 | 3300042609 | Bacteria | 5899 |
| 59 | Ga0466703_105319 | 3300042636 | Bacteria | 11490 |
| 60 | Ga0466708_060946 | 3300042652 | Bacteria | 4665 |
| 61 | Ga0466690_048299 | 3300042590 | Bacteria | 2891 |
| 62 | Ga0466691_035463 | 3300042593 | Bacteria | 12422 |
| 63 | Ga0466691_215169 | 3300042593 | Bacteria | 2256 |
| 64 | Ga0466696_293383 | 3300042596 | Bacteria | 1819 |
| 65 | Ga0466699_130547 | 3300042597 | Bacteria | 7734 |
| 66 | Ga0466699_198049 | 3300042597 | Bacteria | 3091 |
| 67 | Ga0466732_374655 | 3300042656 | Bacteria | 9910 |
| 68 | Ga0123355_10002747 | 3300009826 | Bacteria | 24950 |
| 69 | Ga0466711_166389 | 3300042615 | Bacteria | 5520 |
| 70 | Ga0466715_049473 | 3300042616 | Bacteria | 3360 |
| 71 | Ga0466715_466996 | 3300042616 | Bacteria | 21988 |
| 72 | Ga0466723_339853 | 3300042618 | Bacteria | 5310 |
| 73 | Ga0466726_396381 | 3300042619 | Bacteria | 3013 |
| 74 | Ga0074263_120016 | 3300005485 | Bacteria | 869 |
| 75 | Ga0466717_051556 | 3300042604 | Bacteria | 1011 |
| 76 | Ga0466716_045202 | 3300042605 | Bacteria | 7053 |
| 77 | Ga0466716_309764 | 3300042605 | Bacteria | 10497 |
| 78 | Ga0466722_198820 | 3300042609 | Archaea | 1502 |
| 79 | Ga0466729_253988 | 3300042621 | Bacteria | 3329 |
| 80 | Ga0466703_222162 | 3300042636 | Bacteria | 6922 |
| 81 | Ga0466704_470102 | 3300042643 | Bacteria | 1688 |
| 82 | Ga0466704_567637 | 3300042643 | Bacteria | 1923 |
| 83 | Ga0466709_294638 | 3300042648 | Bacteria | 1408 |
| 84 | Ga0466709_368083 | 3300042648 | Bacteria | 3676 |
| 85 | Ga0264413_118344 | 3300024493 | Unclassified | 2531 |
| 86 | Ga0264413_121518 | 3300024493 | Bacteria | 4131 |
| 87 | Ga0466690_262784 | 3300042590 | Bacteria | 8927 |
| 88 | Ga0466690_284717 | 3300042590 | Bacteria | 1002 |
| 89 | Ga0466692_129597 | 3300042591 | Bacteria | 32139 |
| 90 | Ga0466691_171234 | 3300042593 | Bacteria | 3881 |
| 91 | Ga0466691_176169 | 3300042593 | Bacteria | 7482 |
| 92 | Ga0466694_176799 | 3300042594 | Bacteria | 4214 |
| 93 | Ga0123353_10726072 | 3300010167 | Bacteria | 1388 |
| 94 | Ga0466712_117920 | 3300042614 | Bacteria | 4170 |
| 95 | Ga0466712_252046 | 3300042614 | Bacteria | 7657 |
| 96 | Ga0466723_043734 | 3300042618 | Bacteria | 5568 |
| 97 | Ga0466723_065645 | 3300042618 | Bacteria | 1191 |
| 98 | Ga0466723_120031 | 3300042618 | Unclassified | 5444 |
| 99 | Ga0466723_306181 | 3300042618 | Bacteria | 9042 |
| 100 | Ga0466726_296891 | 3300042619 | Bacteria | 3369 |
| 101 | JGI24698J34947_10000269 | 3300002449 | Bacteria | 22312 |
| 102 | Ga0068305_10027775 | 3300005083 | Bacteria | 2971 |
| 103 | Ga0466707_221556 | 3300042601 | Bacteria | 2266 |
| 104 | Ga0466716_164864 | 3300042605 | Bacteria | 1768 |
| 105 | Ga0466720_040853 | 3300042607 | Bacteria | 2743 |
| 106 | Ga0466731_201918 | 3300042622 | Bacteria | 2321 |
| 107 | Ga0466735_041059 | 3300042624 | Bacteria | 1010 |
| 108 | Ga0466704_098002 | 3300042643 | Bacteria | 7265 |
| 109 | Ga0264413_100102 | 3300024493 | Bacteria | 5114 |
| 110 | Ga0264413_135315 | 3300024493 | Bacteria | 1817 |
| 111 | Ga0466691_014388 | 3300042593 | Bacteria | 7743 |
| 112 | Ga0466694_408492 | 3300042594 | Bacteria | 2297 |
| 113 | Ga0466696_335443 | 3300042596 | Bacteria | 10878 |
| 114 | Ga0466705_028771 | 3300042612 | Bacteria | 7338 |
| 115 | Ga0123356_10278167 | 3300010049 | Bacteria | 1767 |
| 116 | Ga0123353_11200028 | 3300010167 | Bacteria | 996 |
| 117 | Ga0466712_010679 | 3300042614 | Bacteria | 17309 |
| 118 | Ga0466711_273382 | 3300042615 | Bacteria | 13808 |
| 119 | Ga0466715_331108 | 3300042616 | Bacteria | 8763 |
| 120 | Ga0466723_181894 | 3300042618 | Bacteria | 1697 |
| 121 | Ga0466726_088851 | 3300042619 | Bacteria | 2588 |
| 122 | Ga0466726_295122 | 3300042619 | Bacteria | 1599 |
| 123 | Ga0466726_369035 | 3300042619 | Bacteria | 1182 |
| 124 | Ga0466726_488026 | 3300042619 | Bacteria | 1953 |
| 125 | JGI24698J34947_10175858 | 3300002449 | Bacteria | 861 |
| 126 | Ga0072941_1006093 | 3300005201 | Bacteria | 11267 |
| 127 | Ga0123357_10002735 | 3300009784 | Bacteria | 19875 |
| 128 | Ga0466700_209641 | 3300042600 | Bacteria | 1071 |
| 129 | Ga0466722_265072 | 3300042609 | Unclassified | 2386 |
| 130 | Ga0466735_016681 | 3300042624 | Bacteria | 5658 |
| 131 | Ga0466703_003715 | 3300042636 | Bacteria | 3244 |
| 132 | Ga0466703_066941 | 3300042636 | Bacteria | 6179 |
| 133 | Ga0466703_365703 | 3300042636 | Bacteria | 3026 |
| 134 | Ga0466694_272807 | 3300042594 | Bacteria | 4374 |
| 135 | Ga0466705_021484 | 3300042612 | Bacteria | 1243 |
| 136 | Ga0466705_071590 | 3300042612 | Bacteria | 2427 |
| 137 | Ga0123357_10275094 | 3300009784 | Bacteria | 1751 |
| 138 | Ga0123353_10139258 | 3300010167 | Bacteria | 3889 |
| 139 | Ga0466712_023536 | 3300042614 | Bacteria | 1902 |
| 140 | Ga0466712_211291 | 3300042614 | Bacteria | 16887 |
| 141 | Ga0466723_166792 | 3300042618 | Bacteria | 1910 |
| 142 | Ga0466726_028980 | 3300042619 | Bacteria | 4617 |
| 143 | Ga0466726_249740 | 3300042619 | Bacteria | 4999 |
| 144 | JGI24695J34938_10019380 | 3300002450 | Bacteria | 3373 |
| 145 | Ga0466707_167517 | 3300042601 | Bacteria | 1462 |
| 146 | Ga0466716_277014 | 3300042605 | Bacteria | 4656 |
| 147 | Ga0466719_128962 | 3300042606 | Bacteria | 3266 |
| 148 | Ga0466720_018446 | 3300042607 | Bacteria | 2764 |
| 149 | Ga0466703_172606 | 3300042636 | Bacteria | 2890 |
| 150 | Ga0466704_000118 | 3300042643 | Bacteria | 3379 |
| 151 | Ga0466704_257420 | 3300042643 | Bacteria | 19160 |
| 152 | Ga0466709_020612 | 3300042648 | Bacteria | 1147 |
| 153 | Ga0466709_250714 | 3300042648 | Bacteria | 5707 |
| 154 | Ga0466708_185260 | 3300042652 | Bacteria | 27851 |
| 155 | Ga0233288_1060673 | 3300022232 | Bacteria | 1188 |
| 156 | Ga0466691_081320 | 3300042593 | Bacteria | 5007 |
| 157 | Ga0466691_218718 | 3300042593 | Bacteria | 1227 |
| 158 | Ga0466696_142677 | 3300042596 | Bacteria | 1083 |
| 159 | Ga0466705_115351 | 3300042612 | Bacteria | 5953 |
| 160 | Ga0123355_10168152 | 3300009826 | Bacteria | 3284 |
| 161 | Ga0123353_10640734 | 3300010167 | Bacteria | 1507 |
| 162 | Ga0466711_002030 | 3300042615 | Bacteria | 25369 |
| 163 | Ga0466711_278862 | 3300042615 | Bacteria | 2629 |
| 164 | Ga0466715_144217 | 3300042616 | Bacteria | 2020 |
| 165 | Ga0466718_114900 | 3300042617 | Bacteria | 1288 |
| 166 | Ga0466726_480219 | 3300042619 | Bacteria | 1570 |
| 167 | Ga0466729_025921 | 3300042621 | Bacteria | 1027 |
| 168 | Ga0466719_070723 | 3300042606 | Bacteria | 2531 |
| 169 | Ga0466698_316541 | 3300042610 | Bacteria | 1376 |
| 170 | Ga0466735_095333 | 3300042624 | Bacteria | 1103 |
| 171 | Ga0466703_001130 | 3300042636 | Bacteria | 12075 |
| 172 | Ga0466709_326448 | 3300042648 | Bacteria | 1812 |
| 173 | Ga0466690_270153 | 3300042590 | Bacteria | 10347 |
| 174 | Ga0466696_271187 | 3300042596 | Bacteria | 6975 |
| 175 | Ga0466699_415770 | 3300042597 | Bacteria | 1005 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08032 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.