Protein Family IF06376
Metagenome
Isolate
127
Members
40
Samples
124
Scaffolds
396.05
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_246645|Ga0466716_246645_945_2132
- Length
- 384 aa
- Sequence
- MTLLQEKLAKYDAPQKAMAAGIYPYGRMIESDQDTEVQINGKKVLMFGSNAYLGLLNHPKVKEAAIEATRKYGTGCAGSRHLNGTLDIHITLEERLAKLVGKEEVMLYSTGFQVNLGVVSCLTGREDYIIWDELDHASIIEGHRLSYSNKLKYKHNDMDSLEKQLQKCEPDKVKLIVTDGVFSMEGDIANLPEIIALSKKYNASVMVDEAHGIGVLGKNGRGTCDHFGVSQDVDLIMGTFSKSLASIGGFIASNKATINFLRHHSRSYIFSASSTDIMLSEPERIERLWEHTHYALAGFRNMGCEIGHTSTPIIPLYIRDNDLTFLIVRELFDAGVFVNPVVSPXXXPTDTLIRFSLMATHRRDQLDFALDTIRKVFKSHGLIP
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
30.8%
Blattidae
7.7%
Unclassified
7.7%
Termopsidae
7.7%
Passalidae
5.1%
Hodotermitidae
2.6%
Rhinotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_067439 | 3300042590 | Unclassified | 4655 |
| 2 | Ga0466696_078047 | 3300042596 | Bacteria | 9525 |
| 3 | Ga0466716_026041 | 3300042605 | Bacteria | 4791 |
| 4 | Ga0466716_240023 | 3300042605 | Unclassified | 23065 |
| 5 | JGI24702J35022_10009284 | 3300002462 | Bacteria | 5529 |
| 6 | Ga0466727_144223 | 3300042655 | Bacteria | 7333 |
| 7 | Ga0466705_531286 | 3300042612 | Unclassified | 9647 |
| 8 | Ga0466728_180629 | 3300042620 | Unclassified | 3804 |
| 9 | Ga0466728_391319 | 3300042620 | Bacteria | 47879 |
| 10 | Ga0466728_429465 | 3300042620 | Unclassified | 1340 |
| 11 | Ga0466691_051170 | 3300042593 | Bacteria | 30156 |
| 12 | Ga0123353_10095078 | 3300010167 | Bacteria | 4801 |
| 13 | Ga0466706_200638 | 3300042599 | Bacteria | 9777 |
| 14 | Ga0466707_173054 | 3300042601 | Bacteria | 4675 |
| 15 | Ga0466707_224365 | 3300042601 | Bacteria | 6777 |
| 16 | Ga0466707_421782 | 3300042601 | Bacteria | 1315 |
| 17 | Ga0466713_044512 | 3300042602 | Bacteria | 3094 |
| 18 | Ga0466713_155470 | 3300042602 | Bacteria | 25745 |
| 19 | Ga0466719_288509 | 3300042606 | Bacteria | 4632 |
| 20 | JGI24702J35022_10047728 | 3300002462 | Bacteria | 2279 |
| 21 | JGI24705J35276_12238730 | 3300002504 | Bacteria | 46742 |
| 22 | Ga0466703_188996 | 3300042636 | Unclassified | 8613 |
| 23 | Ga0466711_331356 | 3300042615 | Bacteria | 8825 |
| 24 | Ga0466728_042245 | 3300042620 | Bacteria | 5646 |
| 25 | Ga0466705_156841 | 3300042612 | Bacteria | 2728 |
| 26 | Ga0466733_001791 | 3300042659 | Bacteria | 4067 |
| 27 | Ga0466690_138338 | 3300042590 | Unclassified | 4388 |
| 28 | Ga0466691_012156 | 3300042593 | Bacteria | 8598 |
| 29 | Ga0466691_122940 | 3300042593 | Bacteria | 29128 |
| 30 | Ga0466696_259711 | 3300042596 | Bacteria | 25289 |
| 31 | Ga0466696_329395 | 3300042596 | Bacteria | 5595 |
| 32 | Ga0466696_378352 | 3300042596 | Bacteria | 4616 |
| 33 | Ga0123356_10070149 | 3300010049 | Bacteria | 3286 |
| 34 | Ga0466716_094368 | 3300042605 | Bacteria | 6876 |
| 35 | Ga0466722_201664 | 3300042609 | Bacteria | 6207 |
| 36 | JGI24702J35022_10123888 | 3300002462 | Bacteria | 1429 |
| 37 | Ga0466727_287526 | 3300042655 | Bacteria | 4040 |
| 38 | Ga0466705_464125 | 3300042612 | Unclassified | 5582 |
| 39 | Ga0466711_284098 | 3300042615 | Bacteria | 9669 |
| 40 | Ga0466728_126600 | 3300042620 | Bacteria | 8698 |
| 41 | Ga0466691_107231 | 3300042593 | Bacteria | 26006 |
| 42 | Ga0466696_174136 | 3300042596 | Bacteria | 71806 |
| 43 | Ga0466696_224495 | 3300042596 | Bacteria | 11326 |
| 44 | Ga0466713_011826 | 3300042602 | Bacteria | 13991 |
| 45 | Ga0466719_527569 | 3300042606 | Bacteria | 15709 |
| 46 | Ga0068305_10019648 | 3300005083 | Bacteria | 14289 |
| 47 | Ga0072941_1031114 | 3300005201 | Bacteria | 13980 |
| 48 | Ga0466735_172040 | 3300042624 | Bacteria | 3057 |
| 49 | Ga0466703_013190 | 3300042636 | Bacteria | 16034 |
| 50 | Ga0466704_197886 | 3300042643 | Bacteria | 18809 |
| 51 | Ga0466709_023059 | 3300042648 | Bacteria | 19266 |
| 52 | Ga0466709_248151 | 3300042648 | Bacteria | 4613 |
| 53 | Ga0466708_056525 | 3300042652 | Bacteria | 81892 |
| 54 | Ga0466727_123803 | 3300042655 | Bacteria | 15231 |
| 55 | Ga0466727_224853 | 3300042655 | Bacteria | 23233 |
| 56 | Ga0466723_033742 | 3300042618 | Bacteria | 108590 |
| 57 | Ga0466723_302508 | 3300042618 | Bacteria | 10452 |
| 58 | Ga0466728_391606 | 3300042620 | Unclassified | 3843 |
| 59 | Ga0466705_136466 | 3300042612 | Bacteria | 4510 |
| 60 | Ga0466733_056566 | 3300042659 | Bacteria | 66737 |
| 61 | Ga0466690_276263 | 3300042590 | Bacteria | 7139 |
| 62 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 63 | Ga0466700_146839 | 3300042600 | Unclassified | 3891 |
| 64 | Ga0466719_344505 | 3300042606 | Bacteria | 3883 |
| 65 | 2227302996 | 2225789004 | Bacteria | 29771 |
| 66 | JGI24702J35022_10001361 | 3300002462 | Bacteria | 15177 |
| 67 | JGI24702J35022_10013861 | 3300002462 | Bacteria | 4456 |
| 68 | Ga0068305_10014842 | 3300005083 | Bacteria | 10698 |
| 69 | Ga0466735_085063 | 3300042624 | Bacteria | 13418 |
| 70 | Ga0466703_005286 | 3300042636 | Bacteria | 6777 |
| 71 | Ga0466703_419148 | 3300042636 | Bacteria | 10322 |
| 72 | Ga0466704_049568 | 3300042643 | Bacteria | 6330 |
| 73 | Ga0466709_014287 | 3300042648 | Bacteria | 6407 |
| 74 | Ga0466708_210902 | 3300042652 | Bacteria | 8044 |
| 75 | Ga0466711_066442 | 3300042615 | Bacteria | 1303 |
| 76 | Ga0466723_248818 | 3300042618 | Bacteria | 12301 |
| 77 | Ga0466726_422663 | 3300042619 | Bacteria | 2393 |
| 78 | Ga0466726_489858 | 3300042619 | Bacteria | 14478 |
| 79 | Ga0466728_084203 | 3300042620 | Bacteria | 16395 |
| 80 | Ga0466690_104331 | 3300042590 | Bacteria | 9219 |
| 81 | Ga0466696_194149 | 3300042596 | Bacteria | 4084 |
| 82 | Ga0466716_033411 | 3300042605 | Bacteria | 4581 |
| 83 | Ga0466716_491029 | 3300042605 | Bacteria | 12634 |
| 84 | Ga0466719_384150 | 3300042606 | Bacteria | 10216 |
| 85 | 2227133293 | 2225789004 | Bacteria | 1651 |
| 86 | Ga0466703_038519 | 3300042636 | Bacteria | 3516 |
| 87 | Ga0466703_057244 | 3300042636 | Bacteria | 4953 |
| 88 | Ga0466708_148146 | 3300042652 | Unclassified | 13635 |
| 89 | Ga0466708_315337 | 3300042652 | Bacteria | 30097 |
| 90 | Ga0466725_323508 | 3300042654 | Bacteria | 8936 |
| 91 | Ga0466727_022788 | 3300042655 | Unclassified | 3157 |
| 92 | Ga0466723_045946 | 3300042618 | Bacteria | 14034 |
| 93 | Ga0466723_059094 | 3300042618 | Bacteria | 10996 |
| 94 | Ga0466726_017447 | 3300042619 | Bacteria | 18731 |
| 95 | Ga0466728_346068 | 3300042620 | Bacteria | 16431 |
| 96 | Ga0466697_164770 | 3300042611 | Bacteria | 2780 |
| 97 | Ga0466732_346130 | 3300042656 | Bacteria | 4079 |
| 98 | IMNBL1DRAFT_c0004041 | 3300000062 | Bacteria | 9008 |
| 99 | JGI24696J40584_12959080 | 3300002834 | Bacteria | 4692 |
| 100 | Ga0466735_085760 | 3300042624 | Bacteria | 9086 |
| 101 | Ga0466703_273105 | 3300042636 | Bacteria | 5973 |
| 102 | Ga0466704_236011 | 3300042643 | Bacteria | 6480 |
| 103 | Ga0466704_387978 | 3300042643 | Bacteria | 7269 |
| 104 | Ga0466704_489449 | 3300042643 | Bacteria | 27379 |
| 105 | Ga0466708_368256 | 3300042652 | Bacteria | 26611 |
| 106 | Ga0466711_209403 | 3300042615 | Bacteria | 19898 |
| 107 | Ga0466715_099718 | 3300042616 | Bacteria | 10296 |
| 108 | Ga0466723_245046 | 3300042618 | Bacteria | 23052 |
| 109 | Ga0466723_350295 | 3300042618 | Bacteria | 15700 |
| 110 | Ga0466726_063392 | 3300042619 | Bacteria | 8200 |
| 111 | Ga0466728_070459 | 3300042620 | Bacteria | 23231 |
| 112 | Ga0466716_246645 | 3300042605 | Bacteria | 4114 |
| 113 | Ga0466722_064987 | 3300042609 | Bacteria | 5448 |
| 114 | Ga0466698_342604 | 3300042610 | Bacteria | 1726 |
| 115 | Ga0466731_231417 | 3300042622 | Bacteria | 2285 |
| 116 | Ga0466709_173366 | 3300042648 | Bacteria | 10922 |
| 117 | Ga0466727_286513 | 3300042655 | Bacteria | 1204 |
| 118 | Ga0466711_099472 | 3300042615 | Bacteria | 4205 |
| 119 | Ga0466711_271146 | 3300042615 | Bacteria | 6417 |
| 120 | Ga0466715_328233 | 3300042616 | Bacteria | 6858 |
| 121 | Ga0466715_601997 | 3300042616 | Bacteria | 1849 |
| 122 | Ga0466723_003602 | 3300042618 | Bacteria | 21190 |
| 123 | Ga0466728_029447 | 3300042620 | Unclassified | 8851 |
| 124 | Ga0466728_157644 | 3300042620 | Bacteria | 10630 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.