Protein Family IF06350
Metagenome
Isolate
128
Members
44
Samples
124
Scaffolds
219.48
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_163467|Ga0466716_163467_5259_5918
- Length
- 219 aa
- Sequence
- MDDRQWRFKLKKFGQIFVNGLVNENPLLILMIGLCSSLAVTTSVANGIGMGLSMTFVLLMSEFVISLFKKLIPSSVRIPIFIIVIAAFTTIIDYVLQAYFPALSKAMGVFIPLIVVNCIIMGRVEAFASKQPVIYSIADGLGMGLGYTWVLAGISLIRELLGNGSILDIPVFGENYQPVLFFTLPPGGFFVFSLFISLGLYIKQRQSKTPINRNKEGCC
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
33.3%
Unclassified
14.3%
Rhinotermitidae
9.5%
Termopsidae
7.1%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 9 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 10 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_233621 | 3300042612 | Bacteria | 5538 |
| 2 | Ga0466716_299395 | 3300042605 | Bacteria | 2677 |
| 3 | Ga0466698_026555 | 3300042610 | Bacteria | 3352 |
| 4 | Ga0456237_0000677 | 3300041968 | Bacteria | 5199 |
| 5 | Ga0466690_118448 | 3300042590 | Bacteria | 12927 |
| 6 | Ga0466699_178489 | 3300042597 | Bacteria | 6874 |
| 7 | Ga0466726_108905 | 3300042619 | Bacteria | 3052 |
| 8 | JGI24698J34947_10039293 | 3300002449 | Bacteria | 2450 |
| 9 | Ga0466735_233186 | 3300042624 | Bacteria | 2307 |
| 10 | Ga0466709_096447 | 3300042648 | Bacteria | 5475 |
| 11 | Ga0466733_016158 | 3300042659 | Bacteria | 12298 |
| 12 | Ga0466698_212002 | 3300042610 | Bacteria | 1501 |
| 13 | Ga0264413_100076 | 3300024493 | Bacteria | 24181 |
| 14 | Ga0466690_431755 | 3300042590 | Bacteria | 2443 |
| 15 | Ga0466691_015239 | 3300042593 | Bacteria | 10240 |
| 16 | Ga0466694_015175 | 3300042594 | Bacteria | 7200 |
| 17 | Ga0466699_052800 | 3300042597 | Bacteria | 2312 |
| 18 | Ga0466711_137705 | 3300042615 | Bacteria | 18389 |
| 19 | Ga0466715_272887 | 3300042616 | Bacteria | 28734 |
| 20 | Ga0466726_265474 | 3300042619 | Bacteria | 2293 |
| 21 | Ga0466726_426428 | 3300042619 | Bacteria | 5212 |
| 22 | Ga0466728_258797 | 3300042620 | Bacteria | 5080 |
| 23 | JGI24699J35502_11126002 | 3300002509 | Bacteria | 3886 |
| 24 | Ga0068305_10000457 | 3300005083 | Bacteria | 6835 |
| 25 | Ga0068305_10279830 | 3300005083 | Bacteria | 1727 |
| 26 | Ga0072941_1002419 | 3300005201 | Bacteria | 7687 |
| 27 | Ga0466735_040647 | 3300042624 | Unclassified | 1417 |
| 28 | Ga0466703_015673 | 3300042636 | Bacteria | 18639 |
| 29 | Ga0466703_047165 | 3300042636 | Bacteria | 1178 |
| 30 | Ga0466703_215658 | 3300042636 | Bacteria | 2956 |
| 31 | Ga0466705_013927 | 3300042612 | Bacteria | 15021 |
| 32 | Ga0466705_112129 | 3300042612 | Bacteria | 4805 |
| 33 | Ga0466705_227110 | 3300042612 | Bacteria | 9868 |
| 34 | Ga0466719_217203 | 3300042606 | Bacteria | 9135 |
| 35 | Ga0466720_071220 | 3300042607 | Bacteria | 7252 |
| 36 | Ga0466722_169974 | 3300042609 | Bacteria | 1675 |
| 37 | Ga0466690_231472 | 3300042590 | Unclassified | 2902 |
| 38 | Ga0466691_051032 | 3300042593 | Bacteria | 8917 |
| 39 | Ga0466696_050703 | 3300042596 | Bacteria | 49917 |
| 40 | Ga0466715_032569 | 3300042616 | Bacteria | 9902 |
| 41 | JGI24698J34947_10012219 | 3300002449 | Bacteria | 4709 |
| 42 | Ga0466703_135641 | 3300042636 | Bacteria | 4937 |
| 43 | Ga0466704_171804 | 3300042643 | Bacteria | 7129 |
| 44 | Ga0466708_082784 | 3300042652 | Bacteria | 24752 |
| 45 | Ga0466690_419611 | 3300042590 | Bacteria | 2047 |
| 46 | Ga0466692_047409 | 3300042591 | Bacteria | 3006 |
| 47 | Ga0466712_067079 | 3300042614 | Bacteria | 12562 |
| 48 | Ga0466712_112287 | 3300042614 | Bacteria | 5731 |
| 49 | Ga0466718_062257 | 3300042617 | Bacteria | 1651 |
| 50 | Ga0466726_354722 | 3300042619 | Bacteria | 13701 |
| 51 | Ga0466726_405544 | 3300042619 | Bacteria | 5443 |
| 52 | JGI24698J34947_10031561 | 3300002449 | Unclassified | 2787 |
| 53 | JGI24698J34947_10031599 | 3300002449 | Unclassified | 2785 |
| 54 | Ga0072941_1009080 | 3300005201 | Bacteria | 2146 |
| 55 | Ga0466704_183878 | 3300042643 | Bacteria | 1534 |
| 56 | Ga0466704_262422 | 3300042643 | Bacteria | 1875 |
| 57 | Ga0466706_036353 | 3300042599 | Bacteria | 1090 |
| 58 | Ga0466706_172351 | 3300042599 | Bacteria | 5512 |
| 59 | Ga0466707_252833 | 3300042601 | Bacteria | 1605 |
| 60 | Ga0466716_347731 | 3300042605 | Bacteria | 9336 |
| 61 | Ga0466720_135890 | 3300042607 | Bacteria | 17742 |
| 62 | Ga0466698_429491 | 3300042610 | Bacteria | 1435 |
| 63 | Ga0466694_296005 | 3300042594 | Bacteria | 1472 |
| 64 | Ga0466711_029879 | 3300042615 | Bacteria | 23647 |
| 65 | Ga0466711_177408 | 3300042615 | Bacteria | 16419 |
| 66 | Ga0466715_144659 | 3300042616 | Bacteria | 15652 |
| 67 | Ga0466715_289497 | 3300042616 | Bacteria | 3216 |
| 68 | Ga0466723_005794 | 3300042618 | Bacteria | 5450 |
| 69 | Ga0466726_405952 | 3300042619 | Bacteria | 1780 |
| 70 | AustNasuHG_c1000367 | 3300000089 | Bacteria | 15638 |
| 71 | Ga0072941_1004807 | 3300005201 | Bacteria | 12183 |
| 72 | Ga0466735_110333 | 3300042624 | Bacteria | 1639 |
| 73 | Ga0466716_163467 | 3300042605 | Bacteria | 8995 |
| 74 | Ga0466722_233105 | 3300042609 | Bacteria | 4687 |
| 75 | Ga0466690_243507 | 3300042590 | Bacteria | 6031 |
| 76 | Ga0466715_273981 | 3300042616 | Bacteria | 60871 |
| 77 | Ga0466718_003629 | 3300042617 | Unclassified | 4675 |
| 78 | Ga0466718_024150 | 3300042617 | Bacteria | 5457 |
| 79 | Ga0466723_090972 | 3300042618 | Bacteria | 10555 |
| 80 | Ga0466726_305196 | 3300042619 | Bacteria | 2247 |
| 81 | Ga0466729_062744 | 3300042621 | Bacteria | 2948 |
| 82 | AustNasuHG_c1000870 | 3300000089 | Bacteria | 10879 |
| 83 | JGI24698J34947_10041149 | 3300002449 | Bacteria | 2382 |
| 84 | Ga0072940_1015598 | 3300005200 | Bacteria | 1044 |
| 85 | Ga0466731_209400 | 3300042622 | Bacteria | 7378 |
| 86 | Ga0466703_170113 | 3300042636 | Bacteria | 2953 |
| 87 | Ga0466705_343239 | 3300042612 | Bacteria | 6013 |
| 88 | Ga0466733_149704 | 3300042659 | Bacteria | 1267 |
| 89 | Ga0466717_237919 | 3300042604 | Bacteria | 1128 |
| 90 | Ga0466717_294173 | 3300042604 | Bacteria | 1208 |
| 91 | Ga0466719_094611 | 3300042606 | Bacteria | 13765 |
| 92 | Ga0466719_230023 | 3300042606 | Bacteria | 5913 |
| 93 | Ga0466722_069869 | 3300042609 | Bacteria | 16014 |
| 94 | Ga0466722_125659 | 3300042609 | Bacteria | 5104 |
| 95 | Ga0466698_351407 | 3300042610 | Bacteria | 1092 |
| 96 | Ga0466690_064021 | 3300042590 | Unclassified | 2980 |
| 97 | Ga0466690_344927 | 3300042590 | Unclassified | 1247 |
| 98 | Ga0466696_311178 | 3300042596 | Bacteria | 4031 |
| 99 | Ga0466712_213897 | 3300042614 | Bacteria | 3156 |
| 100 | Ga0466715_046121 | 3300042616 | Bacteria | 12463 |
| 101 | Ga0466718_157142 | 3300042617 | Bacteria | 8375 |
| 102 | Ga0466723_271071 | 3300042618 | Bacteria | 28341 |
| 103 | Ga0466723_358439 | 3300042618 | Bacteria | 6638 |
| 104 | Ga0466728_103376 | 3300042620 | Bacteria | 5157 |
| 105 | JGI24698J34947_10049605 | 3300002449 | Unclassified | 2120 |
| 106 | JGI24702J35022_10054181 | 3300002462 | Bacteria | 2139 |
| 107 | Ga0466704_063785 | 3300042643 | Bacteria | 6179 |
| 108 | Ga0466704_111914 | 3300042643 | Bacteria | 32572 |
| 109 | Ga0466727_009613 | 3300042655 | Bacteria | 3623 |
| 110 | Ga0466727_328002 | 3300042655 | Bacteria | 1462 |
| 111 | Ga0466705_360502 | 3300042612 | Bacteria | 1521 |
| 112 | Ga0466706_241452 | 3300042599 | Bacteria | 4436 |
| 113 | Ga0466722_005338 | 3300042609 | Bacteria | 57258 |
| 114 | Ga0466690_310822 | 3300042590 | Bacteria | 1457 |
| 115 | Ga0466691_178771 | 3300042593 | Bacteria | 25640 |
| 116 | Ga0466694_334901 | 3300042594 | Bacteria | 1406 |
| 117 | Ga0466696_009028 | 3300042596 | Bacteria | 7460 |
| 118 | Ga0466712_219812 | 3300042614 | Unclassified | 1240 |
| 119 | Ga0466723_009468 | 3300042618 | Unclassified | 4338 |
| 120 | JGI24698J34947_10018141 | 3300002449 | Bacteria | 3807 |
| 121 | JGI24702J35022_10006728 | 3300002462 | Bacteria | 6626 |
| 122 | Ga0072941_1003408 | 3300005201 | Bacteria | 36537 |
| 123 | Ga0072941_1009078 | 3300005201 | Bacteria | 22637 |
| 124 | Ga0466735_139685 | 3300042624 | Bacteria | 8576 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02508 | Rnf-Nqr | Rnf-Nqr subunit, membrane protein | 15 | 195 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02508 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.