Protein Family IF06348
Metagenome
Isolate
169
Members
51
Samples
153
Scaffolds
180.28
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_142885|Ga0466716_142885_2808_3473
- Length
- 221 aa
- Sequence
- VSLAGKGAAYHQAGGGIQTYRILRNPSPEGEHTGRIIREEYMAELTGTKTEKNLQAAFAGESQARNKYTYYASKAEKEGYNQIGALFRETAEQEKEHAKIWFKLLHGDAVPDTITNLKDAAAGEHYEWTDMYAAFAKEAEEEGFPQIARLFTLVGAIEKEHEQRYRRLLANIEGGLVFSREGERVWQCSNCGHILIGKKSPELCPVCKHPQGYFQIKAENY
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.3%
Kalotermitidae
27.5%
Termitidae
23.5%
Termopsidae
7.8%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 6 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 7 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 8 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 9 | 2820038073 | Unclassified Saccharibacteria Lab288P4bin92 | Isolate | Unclassified |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 20 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 23 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 24 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 28 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 29 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_067254 | 3300042615 | Bacteria | 1607 |
| 2 | Ga0466711_130420 | 3300042615 | Bacteria | 1175 |
| 3 | Ga0466723_063026 | 3300042618 | Unclassified | 1989 |
| 4 | Ga0466723_093387 | 3300042618 | Bacteria | 9872 |
| 5 | Ga0466723_351422 | 3300042618 | Bacteria | 7967 |
| 6 | Ga0466728_167108 | 3300042620 | Bacteria | 1609 |
| 7 | Ga0123355_11549700 | 3300009826 | Bacteria | 642 |
| 8 | Ga0123356_10076249 | 3300010049 | Bacteria | 3159 |
| 9 | Ga0123353_10131198 | 3300010167 | Bacteria | 4021 |
| 10 | Ga0123353_10359807 | 3300010167 | Bacteria | 2187 |
| 11 | Ga0123354_10001101 | 3300010882 | Bacteria | 31338 |
| 12 | Ga0466703_344046 | 3300042636 | Bacteria | 3213 |
| 13 | Ga0466709_164507 | 3300042648 | Bacteria | 3970 |
| 14 | Ga0466708_271634 | 3300042652 | Bacteria | 1025 |
| 15 | Ga0466727_145974 | 3300042655 | Bacteria | 7582 |
| 16 | Ga0466727_287298 | 3300042655 | Bacteria | 1990 |
| 17 | Ga0466690_433358 | 3300042590 | Unclassified | 1330 |
| 18 | Ga0466691_017820 | 3300042593 | Bacteria | 4572 |
| 19 | Ga0466691_050721 | 3300042593 | Bacteria | 4620 |
| 20 | Ga0466705_369185 | 3300042612 | Bacteria | 15586 |
| 21 | Ga0466733_008048 | 3300042659 | Bacteria | 2586 |
| 22 | Ga0466706_071340 | 3300042599 | Bacteria | 1528 |
| 23 | Ga0466717_103579 | 3300042604 | Bacteria | 2690 |
| 24 | Ga0466710_346775 | 3300042613 | Bacteria | 1928 |
| 25 | Ga0466711_166346 | 3300042615 | Bacteria | 23077 |
| 26 | Ga0466715_321443 | 3300042616 | Bacteria | 12692 |
| 27 | Ga0466726_034393 | 3300042619 | Bacteria | 11446 |
| 28 | Ga0466728_072550 | 3300042620 | Bacteria | 18124 |
| 29 | Ga0123356_10051444 | 3300010049 | Bacteria | 3831 |
| 30 | Ga0123356_10137337 | 3300010049 | Bacteria | 2406 |
| 31 | JGI24702J35022_10029782 | 3300002462 | Bacteria | 2929 |
| 32 | Ga0466708_072797 | 3300042652 | Unclassified | 2419 |
| 33 | Ga0466693_313907 | 3300042592 | Bacteria | 31095 |
| 34 | Ga0466693_426415 | 3300042592 | Bacteria | 2740 |
| 35 | Ga0466705_386364 | 3300042612 | Bacteria | 4911 |
| 36 | Ga0466713_057443 | 3300042602 | Bacteria | 5303 |
| 37 | Ga0466719_326976 | 3300042606 | Unclassified | 1658 |
| 38 | Ga0466711_040621 | 3300042615 | Bacteria | 24207 |
| 39 | Ga0466711_176155 | 3300042615 | Bacteria | 3302 |
| 40 | Ga0466711_471259 | 3300042615 | Bacteria | 1458 |
| 41 | Ga0466715_451104 | 3300042616 | Bacteria | 2119 |
| 42 | Ga0466728_096949 | 3300042620 | Unclassified | 24152 |
| 43 | Ga0466728_486292 | 3300042620 | Bacteria | 6042 |
| 44 | Ga0123355_10008959 | 3300009826 | Bacteria | 15160 |
| 45 | Ga0123355_10079031 | 3300009826 | Bacteria | 5255 |
| 46 | Ga0123355_10101309 | 3300009826 | Bacteria | 4533 |
| 47 | Ga0123355_10112282 | 3300009826 | Bacteria | 4254 |
| 48 | Ga0123353_10206673 | 3300010167 | Bacteria | 3083 |
| 49 | Ga0466729_248915 | 3300042621 | Bacteria | 5272 |
| 50 | Ga0466704_114743 | 3300042643 | Bacteria | 17844 |
| 51 | Ga0466704_401044 | 3300042643 | Bacteria | 2774 |
| 52 | Ga0466709_284448 | 3300042648 | Bacteria | 4207 |
| 53 | Ga0466727_319113 | 3300042655 | Unclassified | 1398 |
| 54 | Ga0466696_426303 | 3300042596 | Bacteria | 3476 |
| 55 | Ga0466706_194243 | 3300042599 | Bacteria | 1490 |
| 56 | Ga0466706_283750 | 3300042599 | Bacteria | 2423 |
| 57 | Ga0466707_183113 | 3300042601 | Bacteria | 10864 |
| 58 | Ga0466716_142568 | 3300042605 | Bacteria | 11917 |
| 59 | Ga0466716_538896 | 3300042605 | Bacteria | 1242 |
| 60 | Ga0466719_377327 | 3300042606 | Bacteria | 5604 |
| 61 | Ga0466719_469388 | 3300042606 | Bacteria | 20806 |
| 62 | Ga0466711_439894 | 3300042615 | Bacteria | 5900 |
| 63 | Ga0466715_402371 | 3300042616 | Bacteria | 5830 |
| 64 | Ga0466723_159391 | 3300042618 | Bacteria | 3052 |
| 65 | Ga0466728_221567 | 3300042620 | Bacteria | 4294 |
| 66 | Ga0123357_10003765 | 3300009784 | Bacteria | 17537 |
| 67 | Ga0123356_10015429 | 3300010049 | Bacteria | 7324 |
| 68 | Ga0123353_10248834 | 3300010167 | Bacteria | 2755 |
| 69 | Ga0068302_10210180 | 3300005071 | Bacteria | 1166 |
| 70 | Ga0466704_364789 | 3300042643 | Bacteria | 1900 |
| 71 | Ga0466709_116315 | 3300042648 | Bacteria | 12421 |
| 72 | Ga0466709_221342 | 3300042648 | Bacteria | 1732 |
| 73 | Ga0466690_354714 | 3300042590 | Unclassified | 4492 |
| 74 | Ga0466692_164708 | 3300042591 | Bacteria | 11554 |
| 75 | Ga0466696_441455 | 3300042596 | Bacteria | 1611 |
| 76 | Ga0466697_195707 | 3300042611 | Bacteria | 4649 |
| 77 | Ga0466705_070242 | 3300042612 | Bacteria | 3410 |
| 78 | Ga0466716_142885 | 3300042605 | Bacteria | 4954 |
| 79 | Ga0466719_237369 | 3300042606 | Bacteria | 1360 |
| 80 | Ga0466711_411912 | 3300042615 | Bacteria | 2601 |
| 81 | Ga0466715_359291 | 3300042616 | Bacteria | 2324 |
| 82 | Ga0466723_179425 | 3300042618 | Bacteria | 7519 |
| 83 | Ga0466726_028870 | 3300042619 | Bacteria | 13257 |
| 84 | Ga0466726_156322 | 3300042619 | Bacteria | 33744 |
| 85 | Ga0466726_358815 | 3300042619 | Bacteria | 4497 |
| 86 | Ga0466726_407715 | 3300042619 | Bacteria | 2804 |
| 87 | Ga0123357_10242472 | 3300009784 | Bacteria | 1948 |
| 88 | Ga0123355_10348454 | 3300009826 | Bacteria | 1965 |
| 89 | Ga0123355_10596809 | 3300009826 | Bacteria | 1312 |
| 90 | Ga0123357_10003322 | 3300009784 | Bacteria | 18385 |
| 91 | Ga0466703_296881 | 3300042636 | Bacteria | 1206 |
| 92 | Ga0466703_341216 | 3300042636 | Bacteria | 13567 |
| 93 | Ga0466704_150062 | 3300042643 | Bacteria | 40395 |
| 94 | Ga0466708_051290 | 3300042652 | Unclassified | 2922 |
| 95 | Ga0466727_237513 | 3300042655 | Bacteria | 2675 |
| 96 | Ga0466690_173118 | 3300042590 | Bacteria | 13834 |
| 97 | Ga0466690_270994 | 3300042590 | Bacteria | 9370 |
| 98 | Ga0466691_165071 | 3300042593 | Unclassified | 1035 |
| 99 | Ga0466705_119637 | 3300042612 | Bacteria | 27831 |
| 100 | Ga0466733_199837 | 3300042659 | Bacteria | 6528 |
| 101 | Ga0466706_183344 | 3300042599 | Bacteria | 4155 |
| 102 | Ga0466706_252274 | 3300042599 | Unclassified | 2945 |
| 103 | Ga0466719_324638 | 3300042606 | Bacteria | 8947 |
| 104 | Ga0466711_471191 | 3300042615 | Bacteria | 1078 |
| 105 | Ga0466726_138289 | 3300042619 | Bacteria | 10854 |
| 106 | Ga0466729_128978 | 3300042621 | Bacteria | 18252 |
| 107 | Ga0123356_10009805 | 3300010049 | Bacteria | 9439 |
| 108 | Ga0123353_10000541 | 3300010167 | Bacteria | 46731 |
| 109 | Ga0123353_10179357 | 3300010167 | Bacteria | 3355 |
| 110 | Ga0123354_10013988 | 3300010882 | Bacteria | 12483 |
| 111 | Ga0123354_10094036 | 3300010882 | Bacteria | 4115 |
| 112 | Ga0123354_10230587 | 3300010882 | Bacteria | 1937 |
| 113 | Ga0466704_016572 | 3300042643 | Bacteria | 4282 |
| 114 | Ga0466704_472162 | 3300042643 | Bacteria | 33842 |
| 115 | Ga0466704_514140 | 3300042643 | Bacteria | 62677 |
| 116 | Ga0466690_238645 | 3300042590 | Unclassified | 1555 |
| 117 | Ga0466690_270545 | 3300042590 | Bacteria | 2846 |
| 118 | Ga0466705_118924 | 3300042612 | Bacteria | 2261 |
| 119 | Ga0466707_335609 | 3300042601 | Unclassified | 3648 |
| 120 | Ga0466719_020359 | 3300042606 | Bacteria | 16084 |
| 121 | Ga0466715_160736 | 3300042616 | Bacteria | 22963 |
| 122 | Ga0466715_516007 | 3300042616 | Bacteria | 10841 |
| 123 | Ga0466723_158583 | 3300042618 | Bacteria | 11620 |
| 124 | Ga0466726_392776 | 3300042619 | Bacteria | 1719 |
| 125 | Ga0123356_10043322 | 3300010049 | Unclassified | 4191 |
| 126 | Ga0123356_10063808 | 3300010049 | Bacteria | 3442 |
| 127 | Ga0123353_10020656 | 3300010167 | Bacteria | 9847 |
| 128 | 2227539099 | 2225789004 | Bacteria | 3018 |
| 129 | Ga0123357_10000487 | 3300009784 | Bacteria | 38488 |
| 130 | Ga0466735_079746 | 3300042624 | Bacteria | 1164 |
| 131 | Ga0466703_432061 | 3300042636 | Bacteria | 3095 |
| 132 | Ga0466704_127126 | 3300042643 | Bacteria | 5351 |
| 133 | Ga0466704_500708 | 3300042643 | Bacteria | 15237 |
| 134 | Ga0466691_153740 | 3300042593 | Unclassified | 4608 |
| 135 | Ga0466705_255996 | 3300042612 | Bacteria | 3227 |
| 136 | Ga0466707_009150 | 3300042601 | Bacteria | 2898 |
| 137 | Ga0466716_535305 | 3300042605 | Bacteria | 1091 |
| 138 | Ga0466723_061706 | 3300042618 | Bacteria | 34564 |
| 139 | Ga0466728_342769 | 3300042620 | Bacteria | 1743 |
| 140 | Ga0123355_10176537 | 3300009826 | Bacteria | 3180 |
| 141 | Ga0123355_10433467 | 3300009826 | Unclassified | 1670 |
| 142 | Ga0123356_11380886 | 3300010049 | Bacteria | 865 |
| 143 | Ga0123353_10047097 | 3300010167 | Bacteria | 6854 |
| 144 | Ga0123353_10107412 | 3300010167 | Bacteria | 4497 |
| 145 | Ga0123353_10903203 | 3300010167 | Bacteria | 1202 |
| 146 | Ga0123354_10001111 | 3300010882 | Bacteria | 31280 |
| 147 | Ga0466703_389468 | 3300042636 | Bacteria | 7881 |
| 148 | Ga0466704_327822 | 3300042643 | Bacteria | 22904 |
| 149 | Ga0466704_433116 | 3300042643 | Bacteria | 8034 |
| 150 | Ga0466708_228165 | 3300042652 | Bacteria | 31519 |
| 151 | Ga0466692_178806 | 3300042591 | Bacteria | 32596 |
| 152 | Ga0466691_160045 | 3300042593 | Bacteria | 7154 |
| 153 | Ga0466694_280428 | 3300042594 | Bacteria | 1768 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00210 | GO:0008199 | ferric iron binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.