Protein Family IF06341

Metagenome Isolate
236 Members
63 Samples
220 Scaffolds
159.92 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_126932|Ga0466716_126932_16928_17410
Length
151 aa
Sequence
LIRAAFPGSFDPPTFGHIDIIERSRAIFDELLVVIAENKQKRYLFSAEERRAMMMEMVKKWENVKVMLCGTLIVDLLKGVRNVPDFSYESELSMMNKALSPEIETIFMMTRPEYLVLRSSSVRELAAFNGDLSALVPPIVADALYKKYRKK

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Unclassified 26.7%
Kalotermitidae 23.3%
Rhinotermitidae 5.0%
Termopsidae 5.0%

🌳 Taxonomy

Archaea 0
Bacteria 203
Eukaryota 0
Viruses 0
Unclassified 33

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
9 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
14 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
15 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
16 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
17 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
23 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
32 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
43 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
50 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
51 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
59 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
60 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
61 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
62 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
63 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_101354 3300024493 Unclassified 10101
2 Ga0456237_0001112 3300041968 Bacteria 4255
3 Ga0466691_048019 3300042593 Bacteria 9731
4 Ga0466694_075967 3300042594 Bacteria 18888
5 Ga0466694_156129 3300042594 Bacteria 74614
6 Ga0466694_342602 3300042594 Bacteria 1097
7 Ga0466699_046302 3300042597 Bacteria 1640
8 JGI24698J34947_10093065 3300002449 Unclassified 1377
9 JGI24695J34938_10000014 3300002450 Bacteria 120713
10 JGI24695J34938_10000202 3300002450 Bacteria 56335
11 JGI24695J34938_10002840 3300002450 Bacteria 12644
12 JGI24695J34938_10034913 3300002450 Bacteria 2304
13 Ga0072941_1192702 3300005201 Unclassified 783
14 Ga0466720_114972 3300042607 Bacteria 6930
15 Ga0466721_193641 3300042608 Bacteria 1701
16 Ga0466698_058798 3300042610 Bacteria 1280
17 Ga0466698_319850 3300042610 Bacteria 1040
18 Ga0466702_078676 3300042635 Bacteria 2499
19 Ga0466702_163971 3300042635 Bacteria 1045
20 Ga0466702_425612 3300042635 Bacteria 1502
21 Ga0466703_361363 3300042636 Bacteria 3543
22 Ga0123356_10105801 3300010049 Bacteria 2708
23 Ga0466712_040373 3300042614 Bacteria 28024
24 Ga0466718_050558 3300042617 Bacteria 40017
25 Ga0466718_069866 3300042617 Bacteria 5602
26 Ga0466718_088650 3300042617 Bacteria 7976
27 Ga0466732_023907 3300042656 Bacteria 1280
28 Ga0264413_106747 3300024493 Unclassified 6927
29 Ga0466699_175946 3300042597 Unclassified 4187
30 Ga0466699_224850 3300042597 Bacteria 1853
31 AustNasuHG_c1000433 3300000089 Bacteria 14627
32 AustNasuHG_c1004846 3300000089 Bacteria 4817
33 JGI24698J34947_10018116 3300002449 Unclassified 3810
34 JGI24698J34947_10092898 3300002449 Bacteria 1379
35 JGI24695J34938_10000027 3300002450 Bacteria 107415
36 JGI24695J34938_10000290 3300002450 Unclassified 49669
37 JGI24695J34938_10012056 3300002450 Bacteria 4608
38 JGI24695J34938_10050930 3300002450 Bacteria 1814
39 JGI24695J34938_10124068 3300002450 Bacteria 1051
40 JGI24695J34938_10132571 3300002450 Unclassified 1016
41 Ga0072941_1002459 3300005201 Bacteria 12145
42 Ga0466700_286569 3300042600 Bacteria 2489
43 Ga0466720_037572 3300042607 Bacteria 5544
44 Ga0466720_228314 3300042607 Unclassified 1923
45 Ga0466702_053718 3300042635 Bacteria 1382
46 Ga0123356_10003055 3300010049 Bacteria 17683
47 Ga0123356_10368209 3300010049 Bacteria 1566
48 Ga0466712_000383 3300042614 Bacteria 10159
49 Ga0466712_042589 3300042614 Bacteria 10482
50 Ga0466712_137798 3300042614 Unclassified 4678
51 Ga0466712_318456 3300042614 Unclassified 2412
52 Ga0466718_062043 3300042617 Bacteria 1685
53 Ga0264413_100247 3300024493 Bacteria 36643
54 Ga0466694_225046 3300042594 Bacteria 1510
55 JGI24698J34947_10072874 3300002449 Bacteria 1642
56 JGI24695J34938_10000617 3300002450 Bacteria 33886
57 JGI24695J34938_10007586 3300002450 Bacteria 6320
58 JGI24695J34938_10031296 3300002450 Bacteria 2470
59 Ga0072941_1006644 3300005201 Bacteria 3030
60 Ga0466700_056143 3300042600 Bacteria 8942
61 Ga0466719_159727 3300042606 Bacteria 22160
62 Ga0466719_421818 3300042606 Bacteria 5566
63 Ga0466720_024108 3300042607 Unclassified 4302
64 Ga0466731_187543 3300042622 Bacteria 3525
65 Ga0466708_026959 3300042652 Bacteria 6128
66 Ga0466708_173180 3300042652 Bacteria 4698
67 Ga0123357_10683725 3300009784 Bacteria 743
68 Ga0123356_11006674 3300010049 Bacteria 1003
69 Ga0123356_11017032 3300010049 Bacteria 999
70 Ga0123353_10737896 3300010167 Bacteria 1373
71 Ga0123353_10819480 3300010167 Bacteria 1282
72 Ga0123353_11567554 3300010167 Bacteria 834
73 Ga0466712_043702 3300042614 Unclassified 4694
74 Ga0466711_153420 3300042615 Unclassified 1888
75 Ga0466718_157010 3300042617 Bacteria 1397
76 Ga0466728_368264 3300042620 Bacteria 9341
77 Ga0466728_485374 3300042620 Bacteria 3712
78 Ga0466705_127630 3300042612 Bacteria 2479
79 Ga0456237_0010792 3300041968 Bacteria 1343
80 Ga0466690_352597 3300042590 Unclassified 1925
81 Ga0466694_123045 3300042594 Bacteria 15510
82 Ga0466694_400191 3300042594 Bacteria 1416
83 Ga0466696_017625 3300042596 Bacteria 7735
84 Ga0466696_286644 3300042596 Bacteria 3411
85 Ga0466699_000954 3300042597 Bacteria 10672
86 Ga0466699_147085 3300042597 Bacteria 4059
87 Ga0466699_378204 3300042597 Bacteria 4457
88 FAAS_10001547 3300001880 Unclassified 1071
89 JGI24695J34938_10000648 3300002450 Bacteria 33249
90 JGI24695J34938_10004383 3300002450 Bacteria 9297
91 JGI24695J34938_10006183 3300002450 Unclassified 7277
92 JGI24695J34938_10045461 3300002450 Bacteria 1948
93 Ga0466716_224206 3300042605 Bacteria 6507
94 Ga0466719_244515 3300042606 Bacteria 2265
95 Ga0466735_071443 3300042624 Bacteria 4220
96 Ga0466730_085962 3300042625 Bacteria 1078
97 Ga0123355_10072263 3300009826 Bacteria 5534
98 Ga0123356_10000823 3300010049 Bacteria 34466
99 Ga0123356_12136967 3300010049 Bacteria 699
100 Ga0123353_10034399 3300010167 Bacteria 7907
101 Ga0123353_10780943 3300010167 Bacteria 1323
102 Ga0123353_11355728 3300010167 Bacteria 918
103 Ga0466712_134243 3300042614 Bacteria 18307
104 Ga0466712_149913 3300042614 Bacteria 9599
105 Ga0466711_036291 3300042615 Bacteria 46909
106 Ga0466711_054405 3300042615 Bacteria 2659
107 Ga0466718_027854 3300042617 Unclassified 4760
108 Ga0466718_040825 3300042617 Bacteria 2347
109 Ga0466723_165215 3300042618 Bacteria 6697
110 Ga0466729_043818 3300042621 Bacteria 1427
111 Ga0466705_189089 3300042612 Bacteria 20276
112 Ga0466732_219089 3300042656 Bacteria 12688
113 Ga0264413_101353 3300024493 Bacteria 18890
114 Ga0466690_255897 3300042590 Bacteria 5676
115 Ga0466694_130360 3300042594 Bacteria 3572
116 Ga0466694_213462 3300042594 Bacteria 29362
117 Ga0466696_013107 3300042596 Bacteria 16257
118 JGI24698J34947_10031852 3300002449 Bacteria 2772
119 JGI24698J34947_10063782 3300002449 Bacteria 1804
120 JGI24698J34947_10072070 3300002449 Bacteria 1655
121 JGI24698J34947_10074372 3300002449 Unclassified 1618
122 JGI24698J34947_10089970 3300002449 Bacteria 1411
123 JGI24695J34938_10000597 3300002450 Bacteria 34739
124 JGI24695J34938_10030370 3300002450 Bacteria 2517
125 Ga0068302_10532448 3300005071 Bacteria 953
126 Ga0466720_014621 3300042607 Bacteria 102324
127 Ga0466720_033403 3300042607 Bacteria 16142
128 Ga0466720_150476 3300042607 Bacteria 1367
129 Ga0466731_311231 3300042622 Bacteria 2836
130 Ga0466731_414363 3300042622 Bacteria 1213
131 Ga0466709_242649 3300042648 Bacteria 3734
132 Ga0123356_10001111 3300010049 Bacteria 29832
133 Ga0123356_10006717 3300010049 Bacteria 11589
134 Ga0123356_10220763 3300010049 Bacteria 1952
135 Ga0123356_11843166 3300010049 Bacteria 752
136 Ga0123353_11292616 3300010167 Unclassified 948
137 Ga0123353_11742631 3300010167 Bacteria 778
138 Ga0466705_415987 3300042612 Bacteria 6794
139 Ga0466712_233787 3300042614 Bacteria 9064
140 Ga0466715_390764 3300042616 Bacteria 2252
141 Ga0466718_003181 3300042617 Bacteria 2813
142 Ga0466718_116671 3300042617 Bacteria 5529
143 Ga0466718_160964 3300042617 Bacteria 17624
144 Ga0466723_296019 3300042618 Bacteria 7573
145 Ga0466705_180232 3300042612 Bacteria 7272
146 Ga0466733_173506 3300042659 Bacteria 12784
147 Ga0264413_114910 3300024493 Bacteria 1085
148 Ga0264413_140970 3300024493 Bacteria 1094
149 Ga0466691_068736 3300042593 Bacteria 6070
150 Ga0466694_126897 3300042594 Bacteria 7553
151 Ga0466699_153186 3300042597 Bacteria 4508
152 Ga0466699_337883 3300042597 Bacteria 1067
153 Ga0466699_436417 3300042597 Bacteria 21329
154 JGI24698J34947_10012403 3300002449 Bacteria 4669
155 JGI24695J34938_10000044 3300002450 Bacteria 93214
156 JGI24695J34938_10056547 3300002450 Bacteria 1691
157 Ga0072941_1014206 3300005201 Bacteria 5905
158 Ga0466716_119709 3300042605 Unclassified 1200
159 Ga0466722_101542 3300042609 Bacteria 9184
160 Ga0466731_060359 3300042622 Bacteria 4216
161 Ga0466735_043744 3300042624 Bacteria 2574
162 Ga0466702_355435 3300042635 Bacteria 23082
163 Ga0466727_212043 3300042655 Bacteria 3183
164 Ga0466727_346042 3300042655 Bacteria 1692
165 Ga0123356_10005595 3300010049 Bacteria 12777
166 Ga0123356_10073497 3300010049 Unclassified 3215
167 Ga0123356_10812493 3300010049 Bacteria 1106
168 Ga0123356_11891488 3300010049 Bacteria 743
169 Ga0123356_11957723 3300010049 Bacteria 730
170 Ga0466712_074642 3300042614 Bacteria 2764
171 Ga0466711_342591 3300042615 Bacteria 80397
172 Ga0466718_093960 3300042617 Bacteria 6442
173 Ga0466723_199782 3300042618 Bacteria 1790
174 Ga0264413_110784 3300024493 Unclassified 4523
175 Ga0466693_049301 3300042592 Bacteria 70349
176 Ga0466693_193031 3300042592 Unclassified 2238
177 Ga0466699_434998 3300042597 Bacteria 3399
178 JGI24698J34947_10017257 3300002449 Bacteria 3914
179 JGI24698J34947_10027215 3300002449 Unclassified 3035
180 JGI24698J34947_10148953 3300002449 Unclassified 975
181 JGI24695J34938_10005138 3300002450 Bacteria 8283
182 JGI24695J34938_10083004 3300002450 Bacteria 1322
183 Ga0466719_526232 3300042606 Bacteria 8737
184 Ga0466720_036159 3300042607 Bacteria 8019
185 Ga0466698_280353 3300042610 Bacteria 11875
186 Ga0466731_014287 3300042622 Bacteria 1787
187 Ga0466731_141877 3300042622 Bacteria 1572
188 Ga0466702_440232 3300042635 Bacteria 2631
189 Ga0466704_073305 3300042643 Bacteria 3906
190 Ga0466708_015683 3300042652 Bacteria 8194
191 Ga0466712_026839 3300042614 Unclassified 1234
192 Ga0466712_084967 3300042614 Unclassified 2201
193 Ga0466718_048888 3300042617 Unclassified 13659
194 Ga0466733_032253 3300042659 Bacteria 49484
195 Ga0466733_123122 3300042659 Bacteria 58460
196 Ga0415639_114867 3300038395 Bacteria 3128
197 Ga0466690_173525 3300042590 Bacteria 1650
198 Ga0466694_092959 3300042594 Bacteria 6812
199 JGI24698J34947_10012757 3300002449 Unclassified 4599
200 JGI24695J34938_10001449 3300002450 Bacteria 20095
201 JGI24695J34938_10001635 3300002450 Bacteria 18702
202 JGI24695J34938_10001689 3300002450 Bacteria 18263
203 JGI24695J34938_10008852 3300002450 Unclassified 5686
204 JGI24695J34938_10036178 3300002450 Bacteria 2252
205 JGI24695J34938_10193508 3300002450 Bacteria 845
206 JGI24697J35500_11269875 3300002507 Bacteria 4086
207 Ga0072940_1002370 3300005200 Bacteria 17923
208 Ga0072941_1003241 3300005201 Bacteria 28968
209 Ga0072941_1130396 3300005201 Unclassified 3356
210 Ga0072941_1200015 3300005201 Bacteria 2001
211 Ga0466716_126932 3300042605 Bacteria 45619
212 Ga0466720_012656 3300042607 Bacteria 64589
213 Ga0466720_129108 3300042607 Unclassified 7609
214 Ga0466721_395814 3300042608 Bacteria 2151
215 Ga0466722_131327 3300042609 Bacteria 15597
216 Ga0466703_253417 3300042636 Bacteria 7947
217 Ga0123356_11385829 3300010049 Bacteria 864
218 Ga0123353_10090009 3300010167 Bacteria 4942
219 Ga0466718_067863 3300042617 Bacteria 6021
220 Ga0466723_087969 3300042618 Bacteria 13458

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01467 CTP_transf_like Cytidylyltransferase-like 6 124 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.