Protein Family IF06322

Metagenome Metatranscriptome Isolate
199 Members
81 Samples
174 Scaffolds
345.14 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_085920|Ga0466716_085920_121_1293
Length
390 aa
Sequence
MNICIMPQRKGIELVRHSGFLIAGILNLYDDESMKHCFIDSMGEKTMKALVLEEKKKLSLRDFPTAETVGPYDVKIQIKACGICGSDVHYYLEGAIGDFVVRAPMILGHEAAGIVIEKGEQVRNLAVGDLVCMEPGIPNMRSPEVMDGMYNIDPGVVFWATPPVHGCLRETVVHPAQFCFKLPAGMSAAEGAMMEPLAIGIEAAKKASIKPGDTALVVGCGTIGVMCAISALAGGCGKVFISDVKQEKLDLAGAYDKNIVPVNTLKTDLREFIIKETAGKGCGVIFEASGSPKVYPDFFRCARKGARVVLVGLMNGTVPVDVNFLSAQGITIESIFRYTNCFDRAIALVNAGKIDIKRFISKTFKFEDAIAAYEYAAAGHPDVVKVMIEL

📊 Sample Types

Isolate 12.1%
Metagenome 77.4%
MAG 0.0%
Metatranscriptome 10.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Tenebrionidae 28.2%
Apidae 26.9%
Kalotermitidae 17.9%
Unclassified 7.7%
Termitidae 6.4%
Rhinotermitidae 5.1%
Termopsidae 3.8%
Culicidae 2.6%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 1
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
3 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
4 8074882376 Commensalibacter sp. M0270 Isolate Apidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
10 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
11 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300060699 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
17 3300060706 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
18 3300060708 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300060749 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
23 3300060754 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
24 650716102 Treponema primitia ZAS-2 Isolate Unclassified
25 8074737057 Commensalibacter sp. M0357 Isolate Apidae
26 8074873247 Commensalibacter sp. M0134 Isolate Apidae
27 8074876897 Commensalibacter sp. M0266 Isolate Apidae
28 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
29 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
30 3300060759 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
31 3300060764 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
32 3300060765 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
33 3300060766 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
34 3300060772 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
35 3300060774 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
36 8074745029 Commensalibacter melissae M0407 Isolate Apidae
37 8074748739 Commensalibacter sp. W8133 Isolate Apidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
42 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300060748 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
45 3300060751 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
46 8074871419 Commensalibacter sp. M0133 Isolate Apidae
47 8074884171 Commensalibacter sp. M0355 Isolate Apidae
48 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
52 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
53 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
54 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
55 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
56 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
57 3300060698 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
58 3300061798 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
59 8074743123 Commensalibacter melissae M0402 Isolate Apidae
60 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
61 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
62 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
63 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
64 3300060756 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
65 3300060769 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
66 3300060770 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
67 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
68 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
69 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
70 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
71 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
72 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
73 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
74 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
75 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
76 8074875073 Commensalibacter sp. M0265 Isolate Apidae
77 8074878724 Commensalibacter sp. M0267 Isolate Apidae
78 8074880551 Commensalibacter sp. M0268 Isolate Apidae
79 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
80 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
81 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_177028 3300042612 Bacteria 5081
2 Ga0562375_0359 3300056856 Bacteria 104954
3 Ga0590775_06333 3300060896 Unclassified 1730
4 Ga0466715_258770 3300042616 Bacteria 1408
5 Ga0466726_094093 3300042619 Bacteria 1736
6 Ga0466726_399617 3300042619 Unclassified 2995
7 Ga0466728_442600 3300042620 Bacteria 4085
8 Ga0466735_132073 3300042624 Bacteria 1661
9 Ga0466703_281979 3300042636 Bacteria 2051
10 Ga0466708_171719 3300042652 Bacteria 6379
11 Ga0466708_182888 3300042652 Bacteria 14480
12 Ga0466708_351434 3300042652 Bacteria 21031
13 Ga0466727_209489 3300042655 Bacteria 2779
14 Ga0466727_247129 3300042655 Bacteria 7375
15 Ga0160432_103458 3300012818 Bacteria 2342
16 Ga0466692_072553 3300042591 Bacteria 1748
17 Ga0466691_217421 3300042593 Bacteria 25353
18 Ga0466713_133200 3300042602 Bacteria 3496
19 Ga0466716_085920 3300042605 Unclassified 2687
20 Ga0466716_453433 3300042605 Bacteria 7332
21 Ga0466722_221081 3300042609 Bacteria 2106
22 Ga0466705_345875 3300042612 Bacteria 1202
23 Ga0466733_180886 3300042659 Bacteria 1571
24 Ga0590805_03251 3300060698 Unclassified 1354
25 Ga0590788_04559 3300060765 Unclassified 1589
26 Ga0590793_02273 3300060769 Unclassified 1239
27 Ga0160454_101603 3300012798 Bacteria 3150
28 Ga0466723_124341 3300042618 Unclassified 5812
29 Ga0466723_191310 3300042618 Unclassified 13042
30 Ga0466726_240488 3300042619 Bacteria 5621
31 Ga0466728_018912 3300042620 Bacteria 6345
32 Ga0466728_029509 3300042620 Bacteria 1402
33 Ga0466728_092806 3300042620 Bacteria 8121
34 Ga0466728_160295 3300042620 Unclassified 2202
35 Ga0466728_249126 3300042620 Unclassified 1506
36 Ga0466704_207826 3300042643 Bacteria 1777
37 Ga0466709_144750 3300042648 Bacteria 5915
38 Ga0466709_368369 3300042648 Bacteria 4166
39 Ga0466709_387579 3300042648 Bacteria 1372
40 Ga0466690_118221 3300042590 Bacteria 39842
41 Ga0466690_250028 3300042590 Bacteria 4349
42 Ga0466713_097570 3300042602 Bacteria 2585
43 Ga0466713_131182 3300042602 Bacteria 5703
44 Ga0466713_147240 3300042602 Archaea 7174
45 Ga0466719_164850 3300042606 Unclassified 1489
46 Ga0466719_216569 3300042606 Bacteria 11180
47 Ga0466733_042984 3300042659 Bacteria 3250
48 Ga0562374_0862 3300057007 Bacteria 42445
49 Ga0466705_391893 3300042612 Bacteria 6821
50 Ga0466705_482560 3300042612 Bacteria 8885
51 Ga0466715_095578 3300042616 Bacteria 6097
52 Ga0466723_049591 3300042618 Unclassified 4972
53 Ga0466723_103671 3300042618 Bacteria 2849
54 Ga0466726_203388 3300042619 Bacteria 1438
55 Ga0466728_098635 3300042620 Bacteria 2356
56 Ga0466704_035323 3300042643 Bacteria 7331
57 Ga0466704_147644 3300042643 Bacteria 2667
58 Ga0466704_217618 3300042643 Unclassified 1864
59 Ga0466709_367764 3300042648 Bacteria 15494
60 Ga0466727_160259 3300042655 Unclassified 1364
61 Ga0466727_302722 3300042655 Bacteria 5221
62 Ga0160431_103209 3300012828 Bacteria 3461
63 Ga0160446_100214 3300012835 Unclassified 39522
64 Ga0456237_0000253 3300041968 Bacteria 7820
65 Ga0466690_345389 3300042590 Bacteria 2493
66 Ga0466692_072241 3300042591 Bacteria 6126
67 Ga0466693_278781 3300042592 Bacteria 6688
68 Ga0466691_161258 3300042593 Bacteria 8660
69 Ga0466696_186899 3300042596 Bacteria 28959
70 Ga0466713_105344 3300042602 Bacteria 53182
71 Ga0466722_012107 3300042609 Bacteria 8836
72 Ga0590762_06057 3300060749 Unclassified 1515
73 Ga0466711_025214 3300042615 Bacteria 6087
74 Ga0466711_121629 3300042615 Bacteria 15493
75 Ga0466715_646675 3300042616 Bacteria 6058
76 Ga0466723_126513 3300042618 Bacteria 3083
77 Ga0466723_270192 3300042618 Unclassified 2450
78 Ga0466726_172097 3300042619 Bacteria 10480
79 Ga0466726_214244 3300042619 Bacteria 1887
80 Ga0466726_399829 3300042619 Bacteria 11107
81 Ga0466728_077041 3300042620 Bacteria 1907
82 Ga0466703_006251 3300042636 Bacteria 6154
83 Ga0466703_041211 3300042636 Bacteria 21273
84 Ga0466704_476010 3300042643 Bacteria 3492
85 Ga0466709_348920 3300042648 Bacteria 6096
86 Ga0466709_377760 3300042648 Bacteria 4294
87 Ga0466727_211180 3300042655 Bacteria 2321
88 Ga0160460_101181 3300012845 Bacteria 9948
89 Ga0466690_154565 3300042590 Unclassified 1260
90 Ga0466690_377352 3300042590 Unclassified 2126
91 Ga0466691_168383 3300042593 Bacteria 12520
92 Ga0466696_344367 3300042596 Bacteria 5538
93 Ga0466707_214682 3300042601 Bacteria 1417
94 Ga0466713_120432 3300042602 Bacteria 3816
95 Ga0466714_087941 3300042603 Bacteria 4190
96 Ga0466716_503912 3300042605 Bacteria 3939
97 Ga0466722_052023 3300042609 Unclassified 2119
98 Ga0466722_199430 3300042609 Bacteria 3209
99 Ga0466705_417420 3300042612 Unclassified 2555
100 Ga0466705_512635 3300042612 Unclassified 2936
101 Ga0466711_047053 3300042615 Bacteria 30744
102 Ga0466711_121267 3300042615 Bacteria 13072
103 Ga0466711_379461 3300042615 Bacteria 12930
104 Ga0466735_178763 3300042624 Bacteria 15666
105 Ga0466703_256743 3300042636 Bacteria 7746
106 Ga0466727_073363 3300042655 Bacteria 4243
107 Ga0466690_153446 3300042590 Bacteria 4952
108 Ga0466692_003088 3300042591 Bacteria 16524
109 Ga0466691_000472 3300042593 Bacteria 2710
110 Ga0466707_193595 3300042601 Bacteria 1559
111 Ga0466713_055343 3300042602 Bacteria 3506
112 Ga0466716_089114 3300042605 Bacteria 6426
113 Ga0466719_140625 3300042606 Bacteria 11371
114 Ga0466719_260597 3300042606 Bacteria 6316
115 Ga0466722_162418 3300042609 Bacteria 12534
116 Ga0074278_133158 3300005721 Bacteria 72460
117 Ga0466705_076053 3300042612 Bacteria 41201
118 Ga0466705_236753 3300042612 Bacteria 12299
119 Ga0562376_0002 3300056857 Bacteria 3502070
120 Ga0590806_03745 3300060699 Unclassified 1199
121 Ga0590815_02148 3300060706 Unclassified 3268
122 Ga0590761_06283 3300060748 Unclassified 1295
123 Ga0590772_07401 3300060756 Unclassified 1355
124 Ga0590776_07475 3300060759 Unclassified 1237
125 Ga0590794_06378 3300060770 Unclassified 1177
126 Ga0590770_03671 3300061798 Unclassified 1181
127 Ga0466715_046010 3300042616 Bacteria 15636
128 Ga0466728_042684 3300042620 Bacteria 9092
129 Ga0466729_029425 3300042621 Bacteria 2161
130 Ga0466703_310751 3300042636 Bacteria 1800
131 Ga0466709_308001 3300042648 Bacteria 15552
132 Ga0466694_402863 3300042594 Bacteria 3870
133 Ga0466719_023100 3300042606 Bacteria 11033
134 Ga0466719_125640 3300042606 Bacteria 13314
135 Ga0466719_375271 3300042606 Bacteria 4947
136 Ga0466722_210988 3300042609 Bacteria 7631
137 JGI24700J35501_10930734 3300002508 Bacteria 20835
138 Ga0466705_017642 3300042612 Bacteria 4057
139 Ga0466705_253516 3300042612 Bacteria 2849
140 Ga0590817_05662 3300060708 Unclassified 1288
141 Ga0590764_01961 3300060751 Unclassified 1592
142 Ga0590776_06842 3300060759 Unclassified 1309
143 Ga0590787_09090 3300060764 Unclassified 1130
144 Ga0590796_05667 3300060772 Unclassified 1263
145 Ga0466705_413824 3300042612 Unclassified 3504
146 Ga0466715_376540 3300042616 Bacteria 22885
147 Ga0466726_023122 3300042619 Bacteria 1974
148 Ga0466726_418838 3300042619 Bacteria 9491
149 Ga0466728_223444 3300042620 Bacteria 6073
150 Ga0466703_337284 3300042636 Bacteria 10215
151 Ga0466703_425933 3300042636 Bacteria 7650
152 Ga0466704_254801 3300042643 Bacteria 10052
153 Ga0466709_269585 3300042648 Bacteria 7750
154 Ga0466709_294094 3300042648 Bacteria 2019
155 Ga0466690_029870 3300042590 Bacteria 2652
156 Ga0466696_024085 3300042596 Bacteria 11928
157 Ga0466719_340184 3300042606 Bacteria 2667
158 Ga0466722_007494 3300042609 Bacteria 2659
159 Ga0466733_139898 3300042659 Bacteria 3259
160 Ga0590768_06802 3300060754 Unclassified 1413
161 Ga0590789_04107 3300060766 Unclassified 1266
162 Ga0590798_03423 3300060774 Unclassified 1272
163 Ga0466711_230824 3300042615 Bacteria 16380
164 Ga0466723_054151 3300042618 Bacteria 8067
165 Ga0466703_122224 3300042636 Bacteria 1627
166 Ga0466704_567842 3300042643 Bacteria 2009
167 Ga0466709_108263 3300042648 Bacteria 10567
168 Ga0466708_326964 3300042652 Bacteria 3977
169 Ga0466691_133588 3300042593 Bacteria 5870
170 Ga0466691_143179 3300042593 Bacteria 3925
171 Ga0466696_362530 3300042596 Bacteria 19214
172 Ga0466706_055157 3300042599 Bacteria 1666
173 Ga0466716_214194 3300042605 Bacteria 1462
174 Ga0466719_499124 3300042606 Bacteria 2794

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 223 349 0.93
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 70 183 0.92
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 269 380 0.82

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.