Protein Family IF06320
Metagenome
Isolate
142
Members
56
Samples
125
Scaffolds
131.49
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_076910|Ga0466716_076910_7997_8413
- Length
- 138 aa
- Sequence
- MATLFSRIAAGEIPSHRIAGNDEFFAFLDINPIAEGHTLVIPKKEVDYLFDLDDDVLGRMMTFAKTVARALEQAIPCKRIGLTVIGLEVPHAHIHLVPLQKESDIFFGNPKLKKTPEELAQIAAKIRGKYSAIIQPVS
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
29.1%
Kalotermitidae
25.5%
Termitidae
21.8%
Termopsidae
7.3%
Unclassified
5.5%
Passalidae
5.5%
Rhinotermitidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 19 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 29 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 30 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 44 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 48 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 49 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 50 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 51 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_098163 | 3300042615 | Bacteria | 8093 |
| 2 | Ga0466711_182763 | 3300042615 | Bacteria | 4601 |
| 3 | Ga0466711_443540 | 3300042615 | Bacteria | 17011 |
| 4 | Ga0466715_483459 | 3300042616 | Bacteria | 9809 |
| 5 | Ga0466728_390398 | 3300042620 | Bacteria | 71913 |
| 6 | Ga0123356_11260271 | 3300010049 | Bacteria | 904 |
| 7 | Ga0466707_218341 | 3300042601 | Bacteria | 1548 |
| 8 | Ga0466716_073327 | 3300042605 | Bacteria | 12280 |
| 9 | Ga0466716_335372 | 3300042605 | Bacteria | 21999 |
| 10 | Ga0466719_127736 | 3300042606 | Bacteria | 12085 |
| 11 | Ga0466696_360985 | 3300042596 | Bacteria | 2923 |
| 12 | Ga0466708_120576 | 3300042652 | Bacteria | 34134 |
| 13 | Ga0466727_047526 | 3300042655 | Bacteria | 13694 |
| 14 | Ga0466705_053356 | 3300042612 | Bacteria | 6242 |
| 15 | Ga0466711_058781 | 3300042615 | Bacteria | 7314 |
| 16 | Ga0123353_10295733 | 3300010167 | Bacteria | 2476 |
| 17 | Ga0466706_125382 | 3300042599 | Bacteria | 59039 |
| 18 | Ga0466707_042066 | 3300042601 | Bacteria | 33916 |
| 19 | Ga0466713_027975 | 3300042602 | Bacteria | 1324 |
| 20 | Ga0466716_542452 | 3300042605 | Bacteria | 5808 |
| 21 | Ga0466719_252418 | 3300042606 | Unclassified | 1270 |
| 22 | Ga0466690_087595 | 3300042590 | Bacteria | 13158 |
| 23 | Ga0466696_037645 | 3300042596 | Bacteria | 8146 |
| 24 | Ga0466735_028570 | 3300042624 | Bacteria | 2879 |
| 25 | Ga0466735_109569 | 3300042624 | Bacteria | 1400 |
| 26 | Ga0466703_126384 | 3300042636 | Bacteria | 8446 |
| 27 | Ga0466704_083976 | 3300042643 | Bacteria | 7082 |
| 28 | Ga0466708_381916 | 3300042652 | Bacteria | 41700 |
| 29 | Ga0466705_293308 | 3300042612 | Bacteria | 30605 |
| 30 | Ga0466733_170460 | 3300042659 | Bacteria | 186955 |
| 31 | Ga0466715_120257 | 3300042616 | Bacteria | 34712 |
| 32 | Ga0466718_068814 | 3300042617 | Bacteria | 1429 |
| 33 | Ga0466726_049116 | 3300042619 | Bacteria | 5096 |
| 34 | Ga0466728_273031 | 3300042620 | Bacteria | 99357 |
| 35 | Ga0466728_302644 | 3300042620 | Bacteria | 46015 |
| 36 | Ga0466716_076910 | 3300042605 | Bacteria | 11677 |
| 37 | Ga0466722_068128 | 3300042609 | Bacteria | 5696 |
| 38 | Ga0466722_199911 | 3300042609 | Bacteria | 40153 |
| 39 | Ga0466690_011114 | 3300042590 | Bacteria | 13045 |
| 40 | Ga0466696_143335 | 3300042596 | Bacteria | 1155 |
| 41 | Ga0466703_374666 | 3300042636 | Bacteria | 1379 |
| 42 | 2227108570 | 2225789004 | Bacteria | 39082 |
| 43 | IMNBL1DRAFT_c0000419 | 3300000062 | Bacteria | 35673 |
| 44 | JGI24702J35022_10058473 | 3300002462 | Bacteria | 2059 |
| 45 | Ga0466705_004213 | 3300042612 | Bacteria | 1042 |
| 46 | Ga0466715_016832 | 3300042616 | Bacteria | 13246 |
| 47 | Ga0466723_210560 | 3300042618 | Bacteria | 37552 |
| 48 | Ga0466729_189943 | 3300042621 | Bacteria | 4376 |
| 49 | Ga0123353_10418138 | 3300010167 | Bacteria | 1987 |
| 50 | Ga0466690_161758 | 3300042590 | Bacteria | 3412 |
| 51 | Ga0466696_367296 | 3300042596 | Bacteria | 3420 |
| 52 | Ga0466735_110694 | 3300042624 | Bacteria | 2239 |
| 53 | Ga0466735_207352 | 3300042624 | Bacteria | 2010 |
| 54 | Ga0466735_214580 | 3300042624 | Bacteria | 2171 |
| 55 | Ga0466703_289947 | 3300042636 | Bacteria | 14348 |
| 56 | Ga0466704_488650 | 3300042643 | Bacteria | 2555 |
| 57 | Ga0466727_225961 | 3300042655 | Bacteria | 24553 |
| 58 | JGI24696J40584_12904969 | 3300002834 | Bacteria | 1211 |
| 59 | Ga0068305_10143422 | 3300005083 | Bacteria | 6966 |
| 60 | Ga0466705_384103 | 3300042612 | Bacteria | 6183 |
| 61 | Ga0466710_129526 | 3300042613 | Bacteria | 1517 |
| 62 | Ga0466711_025564 | 3300042615 | Bacteria | 1625 |
| 63 | Ga0466711_254661 | 3300042615 | Bacteria | 22153 |
| 64 | Ga0466711_480922 | 3300042615 | Bacteria | 4951 |
| 65 | Ga0466715_258739 | 3300042616 | Bacteria | 1438 |
| 66 | Ga0466728_427153 | 3300042620 | Bacteria | 44524 |
| 67 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 68 | Ga0466713_138201 | 3300042602 | Bacteria | 41853 |
| 69 | Ga0466716_170454 | 3300042605 | Bacteria | 10208 |
| 70 | Ga0466703_117633 | 3300042636 | Bacteria | 10873 |
| 71 | Ga0466704_407394 | 3300042643 | Bacteria | 14777 |
| 72 | Ga0466709_255680 | 3300042648 | Bacteria | 2123 |
| 73 | Ga0466709_376503 | 3300042648 | Bacteria | 12791 |
| 74 | JGI24702J35022_10033840 | 3300002462 | Bacteria | 2733 |
| 75 | JGI24705J35276_12178884 | 3300002504 | Bacteria | 1350 |
| 76 | Ga0068302_10022099 | 3300005071 | Bacteria | 1549 |
| 77 | Ga0068302_10413639 | 3300005071 | Bacteria | 560 |
| 78 | Ga0466723_337834 | 3300042618 | Bacteria | 4456 |
| 79 | Ga0123353_10812231 | 3300010167 | Bacteria | 1289 |
| 80 | Ga0466706_207386 | 3300042599 | Bacteria | 10137 |
| 81 | Ga0466714_020508 | 3300042603 | Bacteria | 1841 |
| 82 | Ga0466716_506495 | 3300042605 | Bacteria | 2935 |
| 83 | Ga0466719_509416 | 3300042606 | Bacteria | 1300 |
| 84 | Ga0466690_005157 | 3300042590 | Bacteria | 11484 |
| 85 | Ga0466691_157934 | 3300042593 | Bacteria | 3307 |
| 86 | Ga0466694_012818 | 3300042594 | Bacteria | 2704 |
| 87 | Ga0466735_207439 | 3300042624 | Bacteria | 2290 |
| 88 | Ga0466703_334723 | 3300042636 | Bacteria | 11651 |
| 89 | Ga0466704_208378 | 3300042643 | Bacteria | 3095 |
| 90 | Ga0466708_022235 | 3300042652 | Bacteria | 30512 |
| 91 | 2227078002 | 2225789003 | Bacteria | 10156 |
| 92 | Ga0068302_10204565 | 3300005071 | Bacteria | 4487 |
| 93 | Ga0466715_164269 | 3300042616 | Bacteria | 10375 |
| 94 | Ga0466726_298424 | 3300042619 | Bacteria | 2154 |
| 95 | Ga0466726_313388 | 3300042619 | Bacteria | 1954 |
| 96 | Ga0466729_188994 | 3300042621 | Bacteria | 1078 |
| 97 | Ga0466707_308177 | 3300042601 | Bacteria | 5261 |
| 98 | Ga0466713_085697 | 3300042602 | Bacteria | 7961 |
| 99 | Ga0466719_263220 | 3300042606 | Bacteria | 12678 |
| 100 | Ga0466719_343669 | 3300042606 | Bacteria | 7841 |
| 101 | Ga0466704_426718 | 3300042643 | Bacteria | 2219 |
| 102 | Ga0466704_475526 | 3300042643 | Bacteria | 7942 |
| 103 | Ga0466709_201262 | 3300042648 | Bacteria | 3425 |
| 104 | Ga0466725_423711 | 3300042654 | Bacteria | 4648 |
| 105 | IMNBL1DRAFT_c0002120 | 3300000062 | Bacteria | 14126 |
| 106 | JGI24695J34938_10152803 | 3300002450 | Bacteria | 946 |
| 107 | JGI24705J35276_12229120 | 3300002504 | Bacteria | 3323 |
| 108 | Ga0466705_213217 | 3300042612 | Bacteria | 15483 |
| 109 | Ga0466711_279510 | 3300042615 | Bacteria | 6646 |
| 110 | Ga0466728_120091 | 3300042620 | Bacteria | 1456 |
| 111 | Ga0123353_10112877 | 3300010167 | Bacteria | 4375 |
| 112 | Ga0466722_065699 | 3300042609 | Bacteria | 1927 |
| 113 | Ga0466690_352947 | 3300042590 | Bacteria | 7135 |
| 114 | Ga0466690_420312 | 3300042590 | Bacteria | 5387 |
| 115 | Ga0466696_191370 | 3300042596 | Bacteria | 13083 |
| 116 | Ga0466696_304362 | 3300042596 | Bacteria | 42297 |
| 117 | Ga0466703_047779 | 3300042636 | Bacteria | 11370 |
| 118 | Ga0466703_121629 | 3300042636 | Bacteria | 5016 |
| 119 | Ga0466703_249920 | 3300042636 | Bacteria | 2476 |
| 120 | Ga0466704_032420 | 3300042643 | Bacteria | 20055 |
| 121 | Ga0466704_155503 | 3300042643 | Bacteria | 1078 |
| 122 | Ga0466725_072352 | 3300042654 | Bacteria | 12854 |
| 123 | Ga0466727_298968 | 3300042655 | Bacteria | 1168 |
| 124 | Ga0466727_306985 | 3300042655 | Bacteria | 2983 |
| 125 | IMNBL1DRAFT_c0011567 | 3300000062 | Bacteria | 4113 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01230 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.