Protein Family IF06275
Metagenome
Isolate
199
Members
42
Samples
195
Scaffolds
235.61
Avg Length
Representative Sequence
- ID
- 3300042604|Ga0466717_168876|Ga0466717_168876_288_1007
- Length
- 239 aa
- Sequence
- MILSELIQRSPIRIFEQSIHGGLKPGEIGIIASPHGVGKTSVLVQLALDKLLQSKKVIHVSFTPNQRFEHTPYVLAWYEDIFNEFISRKNLENAAEVKNEAVKNRVLMNFNQDGVTKDQIIKSLRALIVEGAFKADSIIIDGFDFSRSDRERIAGVKAFAEEMGLSVWYSCSVNDEGAQYNKENIPVLIKDFADLFDVIIVLDPKSDHVELSISKDRGANAAKSMAMRLDPKTLLILEA
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.1%
Kalotermitidae
33.3%
Unclassified
11.9%
Rhinotermitidae
9.5%
Termopsidae
7.1%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 25 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 30 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_250212 | 3300042612 | Bacteria | 17243 |
| 2 | Ga0466705_287243 | 3300042612 | Bacteria | 21954 |
| 3 | Ga0466711_053854 | 3300042615 | Bacteria | 5450 |
| 4 | Ga0466718_101852 | 3300042617 | Bacteria | 10817 |
| 5 | Ga0466723_098085 | 3300042618 | Bacteria | 1381 |
| 6 | Ga0466726_308105 | 3300042619 | Bacteria | 1827 |
| 7 | Ga0466728_360405 | 3300042620 | Bacteria | 1456 |
| 8 | Ga0456237_0000800 | 3300041968 | Bacteria | 4888 |
| 9 | Ga0466690_396149 | 3300042590 | Bacteria | 1896 |
| 10 | Ga0466691_112263 | 3300042593 | Bacteria | 7165 |
| 11 | Ga0466696_376315 | 3300042596 | Bacteria | 3449 |
| 12 | Ga0466699_269053 | 3300042597 | Bacteria | 3669 |
| 13 | Ga0466735_075675 | 3300042624 | Bacteria | 9853 |
| 14 | Ga0466703_114433 | 3300042636 | Bacteria | 25250 |
| 15 | Ga0466704_185118 | 3300042643 | Bacteria | 9418 |
| 16 | Ga0466709_044151 | 3300042648 | Bacteria | 4177 |
| 17 | Ga0466708_023673 | 3300042652 | Bacteria | 2372 |
| 18 | Ga0123355_10930930 | 3300009826 | Bacteria | 937 |
| 19 | Ga0123356_10605846 | 3300010049 | Bacteria | 1260 |
| 20 | Ga0466719_098136 | 3300042606 | Bacteria | 15758 |
| 21 | Ga0466719_177441 | 3300042606 | Bacteria | 4165 |
| 22 | Ga0466722_193946 | 3300042609 | Bacteria | 1195 |
| 23 | Ga0466711_119569 | 3300042615 | Bacteria | 1137 |
| 24 | Ga0466715_189390 | 3300042616 | Bacteria | 1681 |
| 25 | Ga0466718_053869 | 3300042617 | Unclassified | 1004 |
| 26 | Ga0466723_197841 | 3300042618 | Bacteria | 26173 |
| 27 | Ga0466728_070404 | 3300042620 | Unclassified | 8507 |
| 28 | Ga0466691_099301 | 3300042593 | Bacteria | 9448 |
| 29 | Ga0466691_201235 | 3300042593 | Bacteria | 22831 |
| 30 | Ga0466694_078764 | 3300042594 | Bacteria | 2515 |
| 31 | Ga0466699_431617 | 3300042597 | Bacteria | 2555 |
| 32 | Ga0466729_275178 | 3300042621 | Bacteria | 1760 |
| 33 | Ga0466703_031517 | 3300042636 | Bacteria | 15283 |
| 34 | Ga0466703_153944 | 3300042636 | Bacteria | 4685 |
| 35 | Ga0466703_168004 | 3300042636 | Bacteria | 10074 |
| 36 | Ga0466704_251997 | 3300042643 | Bacteria | 1560 |
| 37 | Ga0466709_297817 | 3300042648 | Unclassified | 1862 |
| 38 | Ga0123353_11139094 | 3300010167 | Bacteria | 1031 |
| 39 | Ga0466716_083529 | 3300042605 | Bacteria | 11509 |
| 40 | Ga0466716_407256 | 3300042605 | Bacteria | 10030 |
| 41 | JGI24698J34947_10039803 | 3300002449 | Bacteria | 2431 |
| 42 | Ga0466705_097765 | 3300042612 | Bacteria | 5243 |
| 43 | Ga0466705_285962 | 3300042612 | Bacteria | 3279 |
| 44 | Ga0466705_291916 | 3300042612 | Bacteria | 1235 |
| 45 | Ga0466705_445340 | 3300042612 | Bacteria | 14158 |
| 46 | Ga0466712_154815 | 3300042614 | Bacteria | 1177 |
| 47 | Ga0466711_235005 | 3300042615 | Bacteria | 7757 |
| 48 | Ga0466711_258143 | 3300042615 | Bacteria | 1333 |
| 49 | Ga0466715_107484 | 3300042616 | Bacteria | 3104 |
| 50 | Ga0466723_135655 | 3300042618 | Bacteria | 14154 |
| 51 | Ga0466723_149815 | 3300042618 | Bacteria | 17280 |
| 52 | Ga0466726_096407 | 3300042619 | Bacteria | 5199 |
| 53 | Ga0466729_049348 | 3300042621 | Bacteria | 1962 |
| 54 | Ga0466690_053732 | 3300042590 | Bacteria | 1630 |
| 55 | Ga0466693_128816 | 3300042592 | Bacteria | 39215 |
| 56 | Ga0466696_178580 | 3300042596 | Bacteria | 13654 |
| 57 | Ga0466696_193559 | 3300042596 | Bacteria | 33901 |
| 58 | Ga0466735_009883 | 3300042624 | Bacteria | 1020 |
| 59 | Ga0466735_090871 | 3300042624 | Bacteria | 1876 |
| 60 | Ga0466702_274456 | 3300042635 | Bacteria | 1099 |
| 61 | Ga0466704_046298 | 3300042643 | Bacteria | 40604 |
| 62 | Ga0466704_110716 | 3300042643 | Bacteria | 1688 |
| 63 | Ga0466708_020109 | 3300042652 | Bacteria | 3147 |
| 64 | Ga0466707_240539 | 3300042601 | Bacteria | 1101 |
| 65 | Ga0466719_331106 | 3300042606 | Bacteria | 1415 |
| 66 | Ga0466698_091101 | 3300042610 | Bacteria | 1059 |
| 67 | Ga0466705_023594 | 3300042612 | Bacteria | 6705 |
| 68 | Ga0466705_235922 | 3300042612 | Bacteria | 2397 |
| 69 | Ga0466712_143567 | 3300042614 | Bacteria | 27408 |
| 70 | Ga0466712_260925 | 3300042614 | Bacteria | 5522 |
| 71 | Ga0466712_296587 | 3300042614 | Bacteria | 1056 |
| 72 | Ga0466711_278247 | 3300042615 | Bacteria | 26787 |
| 73 | Ga0466723_087101 | 3300042618 | Bacteria | 2737 |
| 74 | Ga0466723_097747 | 3300042618 | Bacteria | 3381 |
| 75 | Ga0466723_136318 | 3300042618 | Bacteria | 8810 |
| 76 | Ga0466726_019617 | 3300042619 | Bacteria | 1493 |
| 77 | Ga0466726_234216 | 3300042619 | Bacteria | 1125 |
| 78 | Ga0466728_134049 | 3300042620 | Bacteria | 10088 |
| 79 | Ga0466728_300891 | 3300042620 | Bacteria | 9244 |
| 80 | Ga0466690_261349 | 3300042590 | Bacteria | 1261 |
| 81 | Ga0466691_059158 | 3300042593 | Bacteria | 5837 |
| 82 | Ga0466691_184325 | 3300042593 | Bacteria | 47162 |
| 83 | Ga0466691_200634 | 3300042593 | Bacteria | 13443 |
| 84 | Ga0466694_157302 | 3300042594 | Bacteria | 23788 |
| 85 | Ga0466696_024085 | 3300042596 | Bacteria | 11928 |
| 86 | Ga0466696_144271 | 3300042596 | Bacteria | 1240 |
| 87 | Ga0466699_032953 | 3300042597 | Bacteria | 4610 |
| 88 | Ga0466735_051695 | 3300042624 | Bacteria | 1619 |
| 89 | Ga0466703_090548 | 3300042636 | Bacteria | 7087 |
| 90 | Ga0466703_284215 | 3300042636 | Bacteria | 5385 |
| 91 | Ga0466704_080929 | 3300042643 | Bacteria | 7592 |
| 92 | Ga0466709_007349 | 3300042648 | Bacteria | 3572 |
| 93 | Ga0466709_088329 | 3300042648 | Bacteria | 11205 |
| 94 | Ga0466708_050622 | 3300042652 | Bacteria | 3979 |
| 95 | Ga0466727_131966 | 3300042655 | Bacteria | 2874 |
| 96 | Ga0123356_10003251 | 3300010049 | Bacteria | 17069 |
| 97 | Ga0466717_081346 | 3300042604 | Bacteria | 2104 |
| 98 | Ga0466716_205981 | 3300042605 | Bacteria | 2804 |
| 99 | JGI24698J34947_10013545 | 3300002449 | Bacteria | 4450 |
| 100 | Ga0466705_087188 | 3300042612 | Bacteria | 2536 |
| 101 | Ga0466705_148065 | 3300042612 | Bacteria | 8046 |
| 102 | Ga0466705_190431 | 3300042612 | Bacteria | 7467 |
| 103 | Ga0466712_060461 | 3300042614 | Bacteria | 8499 |
| 104 | Ga0466715_132876 | 3300042616 | Bacteria | 3793 |
| 105 | Ga0466718_043653 | 3300042617 | Bacteria | 5562 |
| 106 | Ga0466728_023539 | 3300042620 | Bacteria | 2872 |
| 107 | Ga0466690_086306 | 3300042590 | Unclassified | 3648 |
| 108 | Ga0466692_145645 | 3300042591 | Bacteria | 20276 |
| 109 | Ga0466691_010365 | 3300042593 | Bacteria | 3487 |
| 110 | Ga0466694_069940 | 3300042594 | Bacteria | 18221 |
| 111 | Ga0466694_102728 | 3300042594 | Bacteria | 1736 |
| 112 | Ga0466696_046868 | 3300042596 | Bacteria | 6131 |
| 113 | Ga0466696_311991 | 3300042596 | Bacteria | 1590 |
| 114 | Ga0466699_296479 | 3300042597 | Unclassified | 1851 |
| 115 | Ga0466703_062931 | 3300042636 | Bacteria | 20998 |
| 116 | Ga0466703_080586 | 3300042636 | Bacteria | 10896 |
| 117 | Ga0466703_097727 | 3300042636 | Bacteria | 30296 |
| 118 | Ga0466703_176764 | 3300042636 | Bacteria | 3818 |
| 119 | Ga0466703_204244 | 3300042636 | Bacteria | 2932 |
| 120 | Ga0466704_123194 | 3300042643 | Bacteria | 12794 |
| 121 | Ga0466704_158308 | 3300042643 | Bacteria | 8204 |
| 122 | Ga0466704_533185 | 3300042643 | Bacteria | 78418 |
| 123 | Ga0466708_171146 | 3300042652 | Bacteria | 7408 |
| 124 | Ga0466708_263039 | 3300042652 | Bacteria | 1149 |
| 125 | Ga0466727_113266 | 3300042655 | Bacteria | 1424 |
| 126 | Ga0466727_157130 | 3300042655 | Bacteria | 2890 |
| 127 | Ga0123356_10829482 | 3300010049 | Bacteria | 1096 |
| 128 | Ga0466719_020973 | 3300042606 | Bacteria | 11343 |
| 129 | Ga0466705_326822 | 3300042612 | Bacteria | 2540 |
| 130 | Ga0466732_189789 | 3300042656 | Bacteria | 5472 |
| 131 | Ga0466723_117444 | 3300042618 | Bacteria | 3012 |
| 132 | Ga0466723_133341 | 3300042618 | Bacteria | 6922 |
| 133 | Ga0466723_356690 | 3300042618 | Bacteria | 6611 |
| 134 | Ga0466726_012666 | 3300042619 | Bacteria | 11909 |
| 135 | Ga0466726_091553 | 3300042619 | Bacteria | 4936 |
| 136 | Ga0466726_352046 | 3300042619 | Bacteria | 1628 |
| 137 | Ga0466728_007696 | 3300042620 | Bacteria | 1332 |
| 138 | Ga0466690_332503 | 3300042590 | Bacteria | 15979 |
| 139 | Ga0466691_026337 | 3300042593 | Bacteria | 4567 |
| 140 | Ga0466691_155027 | 3300042593 | Bacteria | 10291 |
| 141 | Ga0466691_215864 | 3300042593 | Bacteria | 3682 |
| 142 | Ga0466702_075519 | 3300042635 | Bacteria | 2990 |
| 143 | Ga0466703_144945 | 3300042636 | Bacteria | 24122 |
| 144 | Ga0466704_069592 | 3300042643 | Bacteria | 9786 |
| 145 | Ga0466704_328263 | 3300042643 | Bacteria | 3624 |
| 146 | Ga0466709_255597 | 3300042648 | Bacteria | 10287 |
| 147 | Ga0466708_171899 | 3300042652 | Bacteria | 5106 |
| 148 | Ga0466708_321264 | 3300042652 | Unclassified | 3060 |
| 149 | Ga0466707_103158 | 3300042601 | Bacteria | 1171 |
| 150 | Ga0466716_231214 | 3300042605 | Bacteria | 11980 |
| 151 | Ga0466716_276643 | 3300042605 | Bacteria | 16226 |
| 152 | Ga0466716_386028 | 3300042605 | Bacteria | 6053 |
| 153 | JGI24698J34947_10005538 | 3300002449 | Unclassified | 6928 |
| 154 | JGI24698J34947_10083537 | 3300002449 | Bacteria | 1490 |
| 155 | Ga0466718_010967 | 3300042617 | Bacteria | 4972 |
| 156 | Ga0466723_055979 | 3300042618 | Bacteria | 20741 |
| 157 | Ga0466726_286396 | 3300042619 | Bacteria | 3941 |
| 158 | Ga0466728_178148 | 3300042620 | Bacteria | 3312 |
| 159 | Ga0466728_347710 | 3300042620 | Bacteria | 42490 |
| 160 | Ga0466690_152434 | 3300042590 | Bacteria | 4145 |
| 161 | Ga0466696_129863 | 3300042596 | Bacteria | 2988 |
| 162 | Ga0466696_254963 | 3300042596 | Bacteria | 2984 |
| 163 | Ga0466731_365016 | 3300042622 | Bacteria | 3806 |
| 164 | Ga0466703_099715 | 3300042636 | Bacteria | 3192 |
| 165 | Ga0466703_148086 | 3300042636 | Bacteria | 4227 |
| 166 | Ga0466704_177821 | 3300042643 | Bacteria | 1758 |
| 167 | Ga0466704_220003 | 3300042643 | Bacteria | 52311 |
| 168 | Ga0466704_257900 | 3300042643 | Bacteria | 14172 |
| 169 | Ga0466707_415237 | 3300042601 | Bacteria | 1112 |
| 170 | Ga0466717_168876 | 3300042604 | Bacteria | 1801 |
| 171 | Ga0466716_101227 | 3300042605 | Bacteria | 28385 |
| 172 | Ga0466698_006102 | 3300042610 | Bacteria | 3585 |
| 173 | JGI24698J34947_10113457 | 3300002449 | Unclassified | 1191 |
| 174 | JGI24695J34938_10005317 | 3300002450 | Bacteria | 8074 |
| 175 | Ga0466726_268684 | 3300042619 | Bacteria | 1170 |
| 176 | Ga0466726_479180 | 3300042619 | Bacteria | 1364 |
| 177 | Ga0466728_359048 | 3300042620 | Bacteria | 6298 |
| 178 | Ga0466728_380380 | 3300042620 | Unclassified | 1158 |
| 179 | Ga0456237_0001264 | 3300041968 | Bacteria | 4004 |
| 180 | Ga0466690_000502 | 3300042590 | Bacteria | 18399 |
| 181 | Ga0466690_335274 | 3300042590 | Bacteria | 1342 |
| 182 | Ga0466691_039892 | 3300042593 | Bacteria | 15737 |
| 183 | Ga0466691_050768 | 3300042593 | Bacteria | 73218 |
| 184 | Ga0466691_094024 | 3300042593 | Bacteria | 4206 |
| 185 | Ga0466699_166418 | 3300042597 | Bacteria | 12897 |
| 186 | Ga0466703_083705 | 3300042636 | Bacteria | 3250 |
| 187 | Ga0466704_553727 | 3300042643 | Bacteria | 10426 |
| 188 | Ga0466709_251865 | 3300042648 | Bacteria | 18448 |
| 189 | Ga0466709_395777 | 3300042648 | Bacteria | 6408 |
| 190 | Ga0466708_171965 | 3300042652 | Bacteria | 7866 |
| 191 | Ga0466727_281452 | 3300042655 | Bacteria | 2140 |
| 192 | Ga0466707_039129 | 3300042601 | Bacteria | 1558 |
| 193 | Ga0466719_350893 | 3300042606 | Bacteria | 13263 |
| 194 | Ga0466722_198132 | 3300042609 | Bacteria | 1727 |
| 195 | JGI24697J35500_11194491 | 3300002507 | Bacteria | 1615 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.