Protein Family IF06261

Metagenome Isolate
106 Members
34 Samples
100 Scaffolds
276.07 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_103976|Ga0466717_103976_1483_2385
Length
300 aa
Sequence
MISQQPVAKPFSSIWRVQKMSERNKLKVFEDKNIRMEWSEEEDDWYVSIVDVVEVLTNSVDPGAYWRKLKERLKKEGNQTVTNCHTLKMQAADGKMRSADVANTEQLFRLIQSIPSPKAEPFKLWLAQLGKERMDEVADPEIAIDRAFQTYLRKGYSEKWINQRIKTMEVRKDLTDXXQRSGVTKTEEFATLTDIMTKEWSGKTTREYKSFKGLKKENLRDHMTNMELVLNMLAEVSATELSKDTDPIGMVESAKVAKEGGSVAKDARESYEKRSGKKIVSPLNAKNLKALKGDKDGADS

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 70.6%
Unclassified 20.6%
Kalotermitidae 5.9%
Hodotermitidae 2.9%

🌳 Taxonomy

Archaea 1
Bacteria 101
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
2 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
3 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
14 2819999932 Unclassified Synergistetes Th196P4bin51 Isolate Unclassified
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
24 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
28 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
29 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
30 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
31 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
32 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
33 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_126242 3300042599 Bacteria 14752
2 Ga0466731_163325 3300042622 Bacteria 1408
3 Ga0123355_10015891 3300009826 Bacteria 11843
4 Ga0123355_10308504 3300009826 Bacteria 2148
5 Ga0123356_10020769 3300010049 Bacteria 6211
6 Ga0123356_10062196 3300010049 Bacteria 3487
7 Ga0123356_10224557 3300010049 Bacteria 1937
8 Ga0123356_10423900 3300010049 Bacteria 1473
9 Ga0123356_10556921 3300010049 Bacteria 1308
10 Ga0123353_10430042 3300010167 Bacteria 1953
11 Ga0123353_10578278 3300010167 Bacteria 1612
12 Ga0123353_10763012 3300010167 Bacteria 1343
13 Ga0123353_10941241 3300010167 Bacteria 1170
14 Ga0123354_10169152 3300010882 Bacteria 2553
15 Ga0123354_10285618 3300010882 Bacteria 1592
16 Ga0466706_039873 3300042599 Bacteria 9816
17 Ga0466721_164883 3300042608 Bacteria 1840
18 Ga0415639_026303 3300038395 Bacteria 1164
19 Ga0466696_316814 3300042596 Bacteria 1533
20 Ga0123356_10000192 3300010049 Bacteria 70579
21 Ga0123356_10002350 3300010049 Bacteria 20314
22 Ga0123356_10010474 3300010049 Bacteria 9100
23 Ga0123353_10134022 3300010167 Bacteria 3974
24 Ga0123353_10198798 3300010167 Bacteria 3156
25 Ga0123353_10738286 3300010167 Bacteria 1373
26 Ga0123353_10926243 3300010167 Bacteria 1182
27 Ga0123354_10301869 3300010882 Bacteria 1513
28 JGI24695J34938_10038967 3300002450 Bacteria 2150
29 JGI24705J35276_12221633 3300002504 Bacteria 2357
30 JGI24705J35276_12228942 3300002504 Unclassified 3290
31 Ga0466733_066465 3300042659 Bacteria 1413
32 Ga0466697_013534 3300042611 Bacteria 1455
33 Ga0466704_002995 3300042643 Bacteria 8769
34 Ga0415639_072213 3300038395 Bacteria 2464
35 Ga0466696_251434 3300042596 Bacteria 2371
36 Ga0466699_420032 3300042597 Bacteria 1290
37 Ga0123355_10371537 3300009826 Unclassified 1873
38 Ga0123353_10404380 3300010167 Bacteria 2030
39 Ga0123354_10195998 3300010882 Bacteria 2241
40 Ga0466717_103976 3300042604 Bacteria 3847
41 Ga0466721_078666 3300042608 Bacteria 2609
42 Ga0466734_151670 3300042623 Bacteria 1083
43 Ga0466694_161297 3300042594 Bacteria 1539
44 Ga0123357_10026859 3300009784 Bacteria 7778
45 Ga0123355_10001130 3300009826 Bacteria 36984
46 Ga0123356_10134549 3300010049 Bacteria 2427
47 Ga0123356_10551737 3300010049 Bacteria 1313
48 Ga0123356_10929273 3300010049 Bacteria 1041
49 Ga0123353_10478210 3300010167 Bacteria 1824
50 JGI24695J34938_10010502 3300002450 Bacteria 5062
51 JGI24702J35022_10029622 3300002462 Bacteria 2937
52 JGI24702J35022_10134028 3300002462 Bacteria 1377
53 JGI24703J35330_11748859 3300002501 Bacteria 57247
54 Ga0466706_196963 3300042599 Bacteria 3371
55 Ga0466700_070951 3300042600 Bacteria 1525
56 Ga0466707_204506 3300042601 Bacteria 15498
57 Ga0466714_121428 3300042603 Bacteria 2193
58 Ga0466724_01565 3300042649 Bacteria 1185
59 Ga0466718_082425 3300042617 Bacteria 1340
60 Ga0466693_422456 3300042592 Bacteria 1409
61 Ga0123356_10060018 3300010049 Bacteria 3549
62 Ga0123356_10250869 3300010049 Unclassified 1847
63 Ga0123356_10317868 3300010049 Bacteria 1669
64 Ga0123353_10000205 3300010167 Bacteria 75061
65 Ga0123353_10078324 3300010167 Bacteria 5312
66 Ga0123353_10117300 3300010167 Bacteria 4282
67 Ga0123353_10285117 3300010167 Bacteria 2533
68 Ga0123353_10983996 3300010167 Bacteria 1136
69 JGI24702J35022_10004305 3300002462 Bacteria 8488
70 JGI24705J35276_12228860 3300002504 Bacteria 3275
71 Ga0466700_028421 3300042600 Bacteria 2517
72 Ga0466721_011934 3300042608 Unclassified 13505
73 Ga0466721_024270 3300042608 Bacteria 1065
74 Ga0466721_388939 3300042608 Bacteria 2277
75 Ga0123355_10013261 3300009826 Bacteria 12812
76 Ga0123355_10203962 3300009826 Bacteria 2881
77 Ga0123356_10025720 3300010049 Bacteria 5533
78 Ga0123356_10052982 3300010049 Bacteria 3776
79 Ga0123356_10151144 3300010049 Bacteria 2305
80 Ga0123356_10479306 3300010049 Bacteria 1397
81 Ga0123353_11238880 3300010167 Bacteria 975
82 Ga0123354_10100490 3300010882 Bacteria 3914
83 Ga0466721_351832 3300042608 Bacteria 1088
84 Ga0466731_318226 3300042622 Bacteria 3914
85 Ga0466710_457716 3300042613 Bacteria 5410
86 Ga0123357_10176148 3300009784 Bacteria 2514
87 Ga0123356_10413368 3300010049 Bacteria 1489
88 Ga0123354_10292111 3300010882 Bacteria 1560
89 JGI24703J35330_11587711 3300002501 Bacteria 1331
90 Ga0466714_030576 3300042603 Bacteria 3270
91 Ga0466714_166098 3300042603 Bacteria 30529
92 Ga0415639_019700 3300038395 Bacteria 9424
93 Ga0466693_377733 3300042592 Bacteria 1205
94 Ga0466694_178103 3300042594 Bacteria 2640
95 Ga0123355_10457117 3300009826 Bacteria 1605
96 Ga0123356_10057825 3300010049 Bacteria 3615
97 Ga0123353_10683695 3300010167 Bacteria 1444
98 Ga0123353_11031825 3300010167 Bacteria 1101
99 Ga0123354_10331538 3300010882 Bacteria 1386
100 JGI24702J35022_10211020 3300002462 Archaea 1115

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_316814 Ga0466696_316814_21_818 241
2 3300002462 JGI24702J35022_10134028 JGI24702J35022_101340281 244
3 3300010167 Ga0123353_10134022 Ga0123353_101340222 244
4 3300042599 Ga0466706_039873 Ga0466706_039873_5744_6562 244
5 3300042643 Ga0466704_002995 Ga0466704_002995_3857_4705 248
6 3300038395 Ga0415639_072213 Ga0415639_072213_684_1541 249
7 3300010049 Ga0123356_10413368 Ga0123356_104133681 250
8 3300042608 Ga0466721_388939 Ga0466721_388939_212_1066 250
9 3300042603 Ga0466714_166098 Ga0466714_166098_19150_19908 252
10 3300038395 Ga0415639_026303 Ga0415639_026303_376_1146 256
11 3300038395 Ga0415639_019700 Ga0415639_019700_1353_2222 257
12 3300042594 Ga0466694_178103 Ga0466694_178103_1169_2014 257
13 3300010167 Ga0123353_10683695 Ga0123353_106836952 260
14 3300042600 Ga0466700_070951 Ga0466700_070951_108_947 260
15 3300010049 Ga0123356_10479306 Ga0123356_104793062 261
16 3300010049 Ga0123356_10052982 Ga0123356_100529823 262
17 3300042611 Ga0466697_013534 Ga0466697_013534_252_1112 264
18 3300009826 Ga0123355_10203962 Ga0123355_102039622 265
19 3300010167 Ga0123353_10763012 Ga0123353_107630121 265
20 3300010049 Ga0123356_10317868 Ga0123356_103178682 266
21 3300002504 JGI24705J35276_12228860 JGI24705J35276_122288604 267
22 3300009826 Ga0123355_10013261 Ga0123355_100132619 267
23 3300010167 Ga0123353_10000205 Ga0123353_1000020514 267
24 3300042599 Ga0466706_196963 Ga0466706_196963_1420_2361 267
25 3300002450 JGI24695J34938_10010502 JGI24695J34938_100105023 268
26 3300010049 Ga0123356_10010474 Ga0123356_100104748 269
27 3300009826 Ga0123355_10015891 Ga0123355_100158918 271
28 3300042601 Ga0466707_204506 Ga0466707_204506_12194_13009 271
29 3300010049 Ga0123356_10224557 Ga0123356_102245573 272
30 3300010882 Ga0123354_10331538 Ga0123354_103315383 272
31 3300010167 Ga0123353_11238880 Ga0123353_112388801 273
32 iso_pr_bacteria 2820250282 2820250758 273
33 iso_pr_bacteria 2820566695 2820568549 274
34 3300010049 Ga0123356_10002350 Ga0123356_100023507 275
35 3300010049 Ga0123356_10151144 Ga0123356_101511442 275
36 3300010167 Ga0123353_10078324 Ga0123353_100783246 275
37 3300002501 JGI24703J35330_11587711 JGI24703J35330_115877111 276
38 3300042613 Ga0466710_457716 Ga0466710_457716_2762_3592 276
39 3300042608 Ga0466721_011934 Ga0466721_011934_11546_12403 277
40 3300010882 Ga0123354_10169152 Ga0123354_101691523 278
41 3300042603 Ga0466714_030576 Ga0466714_030576_1121_1957 278
42 iso_pr_bacteria 2820563109 2820564073 278
43 3300002501 JGI24703J35330_11748859 JGI24703J35330_117488591 279
44 3300010049 Ga0123356_10000192 Ga0123356_100001926 279
45 3300010049 Ga0123356_10423900 Ga0123356_104239002 279
46 3300010049 Ga0123356_10556921 Ga0123356_105569212 279
47 3300010167 Ga0123353_10404380 Ga0123353_104043803 279
48 3300042600 Ga0466700_028421 Ga0466700_028421_214_1053 279
49 3300009826 Ga0123355_10001130 Ga0123355_100011302 280
50 3300009826 Ga0123355_10457117 Ga0123355_104571172 280
51 3300010049 Ga0123356_10929273 Ga0123356_109292731 280
52 3300010167 Ga0123353_10926243 Ga0123353_109262431 280
53 3300042608 Ga0466721_078666 Ga0466721_078666_1050_1892 280
54 3300042608 Ga0466721_164883 Ga0466721_164883_638_1480 280
55 3300042659 Ga0466733_066465 Ga0466733_066465_287_1129 280
56 3300010167 Ga0123353_10941241 Ga0123353_109412411 281
57 3300042597 Ga0466699_420032 Ga0466699_420032_229_1074 281
58 3300042608 Ga0466721_351832 Ga0466721_351832_162_1007 281
59 3300002504 JGI24705J35276_12221633 JGI24705J35276_122216332 282
60 3300002504 JGI24705J35276_12228942 JGI24705J35276_122289423 282
61 3300009784 Ga0123357_10026859 Ga0123357_100268593 282
62 3300010049 Ga0123356_10060018 Ga0123356_100600181 282
63 3300010049 Ga0123356_10062196 Ga0123356_100621964 282
64 3300010167 Ga0123353_10478210 Ga0123353_104782101 282
65 3300010882 Ga0123354_10100490 Ga0123354_101004903 282
66 3300042608 Ga0466721_024270 Ga0466721_024270_66_914 282
67 3300002462 JGI24702J35022_10211020 JGI24702J35022_102110201 283
68 3300009826 Ga0123355_10371537 Ga0123355_103715374 283
69 3300010049 Ga0123356_10057825 Ga0123356_100578254 283
70 3300010049 Ga0123356_10134549 Ga0123356_101345492 283
71 3300010049 Ga0123356_10250869 Ga0123356_102508693 283
72 3300010167 Ga0123353_10198798 Ga0123353_101987982 283
73 3300042592 Ga0466693_377733 Ga0466693_377733_135_986 283
74 3300042623 Ga0466734_151670 Ga0466734_151670_39_890 283
75 3300010167 Ga0123353_10983996 Ga0123353_109839961 284
76 3300042592 Ga0466693_422456 Ga0466693_422456_227_1081 284
77 3300042594 Ga0466694_161297 Ga0466694_161297_15_869 284
78 3300042622 Ga0466731_163325 Ga0466731_163325_176_1030 284
79 3300042622 Ga0466731_318226 Ga0466731_318226_293_1147 284
80 3300042649 Ga0466724_01565 Ga0466724_01565_146_1000 284
81 iso_pr_bacteria 2820442516 2820443092 284
82 3300002450 JGI24695J34938_10038967 JGI24695J34938_100389672 285
83 3300009784 Ga0123357_10176148 Ga0123357_101761482 285
84 3300009826 Ga0123355_10308504 Ga0123355_103085043 285
85 3300010167 Ga0123353_10117300 Ga0123353_101173004 285
86 3300010167 Ga0123353_10430042 Ga0123353_104300423 285
87 3300010167 Ga0123353_10578278 Ga0123353_105782782 285
88 3300010167 Ga0123353_11031825 Ga0123353_110318252 285
89 3300010882 Ga0123354_10195998 Ga0123354_101959983 285
90 3300010882 Ga0123354_10285618 Ga0123354_102856182 285
91 3300042603 Ga0466714_121428 Ga0466714_121428_607_1464 285
92 3300042617 Ga0466718_082425 Ga0466718_082425_357_1214 285
93 iso_pr_bacteria 2820587002 2820589158 285
94 3300010167 Ga0123353_10285117 Ga0123353_102851173 286
95 3300010882 Ga0123354_10301869 Ga0123354_103018692 286
96 3300010167 Ga0123353_10738286 Ga0123353_107382862 288
97 3300010882 Ga0123354_10292111 Ga0123354_102921112 288
98 iso_pr_bacteria 2819999932 2820001600 288
99 3300002462 JGI24702J35022_10004305 JGI24702J35022_100043055 289
100 3300002462 JGI24702J35022_10029622 JGI24702J35022_100296224 289
101 3300010049 Ga0123356_10025720 Ga0123356_100257202 289
102 3300010049 Ga0123356_10551737 Ga0123356_105517371 289
103 3300042596 Ga0466696_251434 Ga0466696_251434_935_1804 289
104 3300010049 Ga0123356_10020769 Ga0123356_100207692 290
105 3300042599 Ga0466706_126242 Ga0466706_126242_4063_4944 293
106 3300042604 Ga0466717_103976 Ga0466717_103976_1483_2385 300

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02498 Bro-N BRO family, N-terminal domain 34 128 0.78

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.68 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.