Protein Family IF06217
Metagenome
Isolate
111
Members
43
Samples
107
Scaffolds
328.56
Avg Length
Representative Sequence
- ID
- 3300042603|Ga0466714_121005|Ga0466714_121005_58_1074
- Length
- 338 aa
- Sequence
- MNIGNIDLGARPLLLAPMEDVTDRSFRAMCKGFGADMVYTEFISSDGLIRDAAKSLAKLRLEDDERPVGVQIYGHLIEPMVEAARMAESAHPDVIDINFGCPVKKIANRGAGSGMMREPDKMVEMTRRIVDAIGGRVPVTVKTRLGWDENSKNIEELAVRLQDTGIAALTIHGRTRAQLYKGEADWTLIGAVKANPAIHIPIIGNGDISSPEGALQAFEHWGVDGVMIGRATYGRPWIFREIKHYLATGDLLPQPGVTERVEIARRHLLKSIEVKGEKVGILEMRRHLSSYFKGLPDFKATRLALVTENDPAELLRTLNTIADRWGTCDMSTTIPKLW
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
28.6%
Unclassified
14.3%
Rhinotermitidae
7.1%
Termopsidae
7.1%
Passalidae
4.8%
Hodotermitidae
2.4%
Armadillidiidae
2.4%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 27 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_215256 | 3300042659 | Bacteria | 12452 |
| 2 | Ga0123353_10289739 | 3300010167 | Bacteria | 2507 |
| 3 | Ga0466735_113613 | 3300042624 | Bacteria | 55484 |
| 4 | Ga0466709_306520 | 3300042648 | Bacteria | 32391 |
| 5 | Ga0466727_171731 | 3300042655 | Bacteria | 7273 |
| 6 | Ga0466690_086439 | 3300042590 | Bacteria | 16955 |
| 7 | Ga0466690_130420 | 3300042590 | Bacteria | 14691 |
| 8 | Ga0466711_035243 | 3300042615 | Bacteria | 2887 |
| 9 | Ga0466711_262846 | 3300042615 | Bacteria | 4229 |
| 10 | Ga0466726_136512 | 3300042619 | Bacteria | 5622 |
| 11 | Ga0466728_096900 | 3300042620 | Bacteria | 18697 |
| 12 | Ga0466714_139388 | 3300042603 | Bacteria | 2961 |
| 13 | Ga0466714_145613 | 3300042603 | Bacteria | 8089 |
| 14 | Ga0466719_338690 | 3300042606 | Bacteria | 10986 |
| 15 | Ga0466733_220562 | 3300042659 | Bacteria | 26223 |
| 16 | Ga0466708_329587 | 3300042652 | Bacteria | 27124 |
| 17 | Ga0466727_103024 | 3300042655 | Bacteria | 46807 |
| 18 | Ga0466692_090043 | 3300042591 | Bacteria | 13167 |
| 19 | Ga0466691_031362 | 3300042593 | Bacteria | 18999 |
| 20 | Ga0466691_060058 | 3300042593 | Bacteria | 6144 |
| 21 | Ga0466696_469704 | 3300042596 | Bacteria | 17887 |
| 22 | Ga0466710_217192 | 3300042613 | Bacteria | 1107 |
| 23 | Ga0466723_050572 | 3300042618 | Bacteria | 48539 |
| 24 | Ga0466723_088812 | 3300042618 | Bacteria | 33295 |
| 25 | Ga0466728_043092 | 3300042620 | Bacteria | 5634 |
| 26 | Ga0466706_167981 | 3300042599 | Bacteria | 2047 |
| 27 | Ga0466706_241205 | 3300042599 | Bacteria | 7752 |
| 28 | Ga0466714_106262 | 3300042603 | Bacteria | 5677 |
| 29 | Ga0466714_114517 | 3300042603 | Unclassified | 1728 |
| 30 | JGI24705J35276_12233962 | 3300002504 | Bacteria | 5166 |
| 31 | Ga0072941_1057410 | 3300005201 | Bacteria | 4618 |
| 32 | Ga0466733_104669 | 3300042659 | Bacteria | 2363 |
| 33 | Ga0123353_10100014 | 3300010167 | Bacteria | 4674 |
| 34 | Ga0123354_10059988 | 3300010882 | Bacteria | 5636 |
| 35 | Ga0466735_019897 | 3300042624 | Bacteria | 1835 |
| 36 | Ga0160433_100003 | 3300012846 | Bacteria | 588956 |
| 37 | Ga0466690_082225 | 3300042590 | Bacteria | 3385 |
| 38 | Ga0466723_026766 | 3300042618 | Bacteria | 20254 |
| 39 | Ga0466726_297935 | 3300042619 | Bacteria | 15869 |
| 40 | Ga0466706_027307 | 3300042599 | Bacteria | 8243 |
| 41 | Ga0466706_243833 | 3300042599 | Bacteria | 35703 |
| 42 | Ga0466707_104252 | 3300042601 | Bacteria | 29636 |
| 43 | Ga0466714_121005 | 3300042603 | Bacteria | 1417 |
| 44 | Ga0466719_135924 | 3300042606 | Bacteria | 3463 |
| 45 | Ga0466719_447284 | 3300042606 | Bacteria | 1365 |
| 46 | Ga0466719_569598 | 3300042606 | Bacteria | 1522 |
| 47 | Ga0466732_394282 | 3300042656 | Bacteria | 3674 |
| 48 | Ga0466733_140048 | 3300042659 | Bacteria | 2199 |
| 49 | Ga0466703_057883 | 3300042636 | Bacteria | 1935 |
| 50 | Ga0466703_164345 | 3300042636 | Bacteria | 2913 |
| 51 | Ga0466704_182939 | 3300042643 | Bacteria | 26244 |
| 52 | Ga0466709_253747 | 3300042648 | Bacteria | 11213 |
| 53 | Ga0466692_148599 | 3300042591 | Bacteria | 25005 |
| 54 | Ga0466691_013740 | 3300042593 | Bacteria | 7144 |
| 55 | Ga0466695_011493 | 3300042595 | Bacteria | 7966 |
| 56 | Ga0466696_068321 | 3300042596 | Bacteria | 30966 |
| 57 | Ga0466696_444554 | 3300042596 | Bacteria | 19303 |
| 58 | Ga0466715_394361 | 3300042616 | Bacteria | 29774 |
| 59 | Ga0466706_189508 | 3300042599 | Bacteria | 6205 |
| 60 | Ga0466713_090832 | 3300042602 | Bacteria | 1746 |
| 61 | Ga0466722_024855 | 3300042609 | Bacteria | 3371 |
| 62 | 2227080791 | 2225789004 | Bacteria | 41979 |
| 63 | Ga0466733_199714 | 3300042659 | Bacteria | 1378 |
| 64 | Ga0123353_10839990 | 3300010167 | Bacteria | 1261 |
| 65 | Ga0466735_106211 | 3300042624 | Bacteria | 5340 |
| 66 | Ga0466704_329161 | 3300042643 | Bacteria | 13717 |
| 67 | Ga0466709_116749 | 3300042648 | Bacteria | 5788 |
| 68 | Ga0466696_131205 | 3300042596 | Bacteria | 6038 |
| 69 | Ga0466705_200811 | 3300042612 | Bacteria | 28689 |
| 70 | Ga0466712_164773 | 3300042614 | Bacteria | 4171 |
| 71 | Ga0466714_024607 | 3300042603 | Bacteria | 3505 |
| 72 | Ga0466716_278916 | 3300042605 | Bacteria | 5730 |
| 73 | IMNBL1DRAFT_c0000765 | 3300000062 | Bacteria | 25410 |
| 74 | Ga0466733_077031 | 3300042659 | Bacteria | 1828 |
| 75 | Ga0466708_286335 | 3300042652 | Bacteria | 16948 |
| 76 | Ga0466727_331606 | 3300042655 | Bacteria | 3674 |
| 77 | Ga0466657_022404 | 3300042582 | Bacteria | 1458 |
| 78 | Ga0466705_499005 | 3300042612 | Bacteria | 6837 |
| 79 | Ga0466711_374933 | 3300042615 | Bacteria | 11087 |
| 80 | Ga0466723_082619 | 3300042618 | Bacteria | 11941 |
| 81 | Ga0466726_397794 | 3300042619 | Bacteria | 2189 |
| 82 | Ga0466706_082540 | 3300042599 | Bacteria | 29832 |
| 83 | Ga0466706_271736 | 3300042599 | Bacteria | 20455 |
| 84 | Ga0466716_327426 | 3300042605 | Unclassified | 3177 |
| 85 | Ga0466698_274738 | 3300042610 | Bacteria | 1259 |
| 86 | JGI24702J35022_10000040 | 3300002462 | Bacteria | 53566 |
| 87 | Ga0072941_1125529 | 3300005201 | Bacteria | 8566 |
| 88 | Ga0123353_10422217 | 3300010167 | Bacteria | 1975 |
| 89 | Ga0123354_10155126 | 3300010882 | Bacteria | 2751 |
| 90 | Ga0466690_166181 | 3300042590 | Bacteria | 6899 |
| 91 | Ga0466696_376429 | 3300042596 | Unclassified | 3820 |
| 92 | Ga0466705_037266 | 3300042612 | Bacteria | 15010 |
| 93 | Ga0466715_396858 | 3300042616 | Bacteria | 5135 |
| 94 | Ga0466729_117836 | 3300042621 | Bacteria | 8278 |
| 95 | Ga0466706_270551 | 3300042599 | Bacteria | 39934 |
| 96 | Ga0466703_077266 | 3300042636 | Bacteria | 1275 |
| 97 | Ga0466690_104609 | 3300042590 | Bacteria | 7141 |
| 98 | Ga0466691_111772 | 3300042593 | Bacteria | 94015 |
| 99 | Ga0466691_200204 | 3300042593 | Bacteria | 12641 |
| 100 | Ga0466711_084790 | 3300042615 | Bacteria | 9381 |
| 101 | Ga0466715_363781 | 3300042616 | Bacteria | 3940 |
| 102 | Ga0466723_207102 | 3300042618 | Bacteria | 16383 |
| 103 | Ga0466728_286718 | 3300042620 | Bacteria | 11512 |
| 104 | Ga0466729_156825 | 3300042621 | Bacteria | 2537 |
| 105 | Ga0466714_163280 | 3300042603 | Bacteria | 2218 |
| 106 | Ga0466716_154063 | 3300042605 | Bacteria | 2465 |
| 107 | IMNBL1DRAFT_c0001903 | 3300000062 | Bacteria | 15106 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01207 | Dus | Dihydrouridine synthase (Dus) | 14 | 319 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.