Protein Family IF06186
Metagenome
Metatranscriptome
Isolate
277
Members
80
Samples
246
Scaffolds
247.32
Avg Length
Representative Sequence
- ID
- 3300042603|Ga0466714_039597|Ga0466714_039597_49_798
- Length
- 249 aa
- Sequence
- MRRKVIAGNWKMNMLPDETMNFIEKFAPLVKDSKAEAILCVPYIDLFYAISNAQGTNVKIGAQNMHWEEKGAYTGEVSGNMLKKIGVEYVIIGHSERRAYFAETDETVNKKVKAALGYGLKPIVCVGESLEQRESGTTKQIITTQTRKGLEGLTAADLDTVIIAYEPIWAIGTGKTATAEDANESVKWIREEVASIFGSDVADKIIIQYGGSVKSSNATELFGMSDIDGGLVGGASMEAEEFSKIVNAG
Sample Types
Isolate
11.2%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.5%
Unclassified
37.2%
Kalotermitidae
16.7%
Termopsidae
3.8%
Rhinotermitidae
2.6%
Culicidae
1.3%
Taxonomy
Archaea
0
Bacteria
237
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 2 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 3 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 4 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 5 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 6 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 7 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 8 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 9 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2964266314 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 21 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 22 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 23 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 24 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 34 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 35 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 36 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 37 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 41 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 42 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 43 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 44 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 52 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 53 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 56 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 64 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 65 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 66 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 67 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 68 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 69 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 70 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 71 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 72 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 73 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 74 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 75 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 76 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 77 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 78 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_167313 | 3300042656 | Bacteria | 1053 |
| 2 | JGI24698J34947_10009031 | 3300002449 | Bacteria | 5469 |
| 3 | JGI24698J34947_10073171 | 3300002449 | Unclassified | 1637 |
| 4 | JGI24695J34938_10000426 | 3300002450 | Bacteria | 40565 |
| 5 | JGI24695J34938_10038384 | 3300002450 | Bacteria | 2170 |
| 6 | Ga0072940_1003097 | 3300005200 | Unclassified | 11521 |
| 7 | Ga0072941_1002393 | 3300005201 | Unclassified | 2238 |
| 8 | Ga0072941_1022836 | 3300005201 | Bacteria | 9467 |
| 9 | Ga0074263_107378 | 3300005485 | Unclassified | 1624 |
| 10 | Ga0074263_125635 | 3300005485 | Unclassified | 841 |
| 11 | Ga0415639_009192 | 3300038395 | Bacteria | 4004 |
| 12 | Ga0415639_021951 | 3300038395 | Bacteria | 22923 |
| 13 | Ga0466694_099769 | 3300042594 | Bacteria | 27983 |
| 14 | Ga0466695_315985 | 3300042595 | Bacteria | 38906 |
| 15 | Ga0123355_10017672 | 3300009826 | Bacteria | 11281 |
| 16 | Ga0123356_10000512 | 3300010049 | Bacteria | 43209 |
| 17 | Ga0466717_192321 | 3300042604 | Bacteria | 1522 |
| 18 | Ga0466720_067030 | 3300042607 | Bacteria | 12063 |
| 19 | Ga0466720_080544 | 3300042607 | Bacteria | 2921 |
| 20 | Ga0466720_122176 | 3300042607 | Unclassified | 5005 |
| 21 | Ga0466721_040497 | 3300042608 | Bacteria | 19632 |
| 22 | Ga0466698_345041 | 3300042610 | Bacteria | 4303 |
| 23 | Ga0466718_062741 | 3300042617 | Bacteria | 4364 |
| 24 | Ga0466723_246154 | 3300042618 | Bacteria | 7739 |
| 25 | Ga0466726_081206 | 3300042619 | Bacteria | 1121 |
| 26 | Ga0466702_141190 | 3300042635 | Bacteria | 4112 |
| 27 | Ga0466732_045972 | 3300042656 | Bacteria | 3427 |
| 28 | JGI24698J34947_10005067 | 3300002449 | Bacteria | 7216 |
| 29 | JGI24698J34947_10059486 | 3300002449 | Unclassified | 1888 |
| 30 | JGI24698J34947_10074549 | 3300002449 | Bacteria | 1616 |
| 31 | JGI24695J34938_10001322 | 3300002450 | Bacteria | 21497 |
| 32 | JGI24695J34938_10001656 | 3300002450 | Bacteria | 18523 |
| 33 | JGI24695J34938_10003988 | 3300002450 | Bacteria | 9946 |
| 34 | JGI24695J34938_10030387 | 3300002450 | Unclassified | 2516 |
| 35 | JGI24695J34938_10043283 | 3300002450 | Bacteria | 2010 |
| 36 | JGI24700J35501_10930629 | 3300002508 | Bacteria | 17022 |
| 37 | Ga0072941_1027018 | 3300005201 | Unclassified | 11126 |
| 38 | Ga0264413_105958 | 3300024493 | Bacteria | 8222 |
| 39 | Ga0415639_041734 | 3300038395 | Bacteria | 4896 |
| 40 | Ga0415639_072417 | 3300038395 | Bacteria | 2258 |
| 41 | Ga0466690_004515 | 3300042590 | Bacteria | 6070 |
| 42 | Ga0466693_431826 | 3300042592 | Bacteria | 2237 |
| 43 | Ga0466699_208428 | 3300042597 | Bacteria | 4168 |
| 44 | Ga0466701_001536 | 3300042598 | Bacteria | 2370 |
| 45 | Ga0123356_10000007 | 3300010049 | Bacteria | 240704 |
| 46 | Ga0123356_10001693 | 3300010049 | Bacteria | 24130 |
| 47 | Ga0123356_10056106 | 3300010049 | Bacteria | 3669 |
| 48 | Ga0123356_10602177 | 3300010049 | Bacteria | 1264 |
| 49 | Ga0123356_10704344 | 3300010049 | Bacteria | 1179 |
| 50 | Ga0123353_10112341 | 3300010167 | Bacteria | 4387 |
| 51 | Ga0123353_10189951 | 3300010167 | Bacteria | 3243 |
| 52 | Ga0123353_10857562 | 3300010167 | Bacteria | 1244 |
| 53 | Ga0466700_022495 | 3300042600 | Bacteria | 1010 |
| 54 | Ga0466714_039597 | 3300042603 | Bacteria | 1917 |
| 55 | Ga0466719_572738 | 3300042606 | Bacteria | 5163 |
| 56 | Ga0466720_069399 | 3300042607 | Unclassified | 1303 |
| 57 | Ga0466720_233106 | 3300042607 | Bacteria | 42880 |
| 58 | Ga0466712_033199 | 3300042614 | Bacteria | 31590 |
| 59 | Ga0466715_607081 | 3300042616 | Bacteria | 3049 |
| 60 | Ga0466718_004325 | 3300042617 | Unclassified | 1479 |
| 61 | Ga0466718_079470 | 3300042617 | Bacteria | 7118 |
| 62 | Ga0466718_079501 | 3300042617 | Bacteria | 20186 |
| 63 | Ga0466718_080383 | 3300042617 | Bacteria | 8432 |
| 64 | Ga0466718_093583 | 3300042617 | Bacteria | 5456 |
| 65 | Ga0466705_254831 | 3300042612 | Bacteria | 10398 |
| 66 | Ga0466731_218809 | 3300042622 | Bacteria | 1521 |
| 67 | Ga0466735_223630 | 3300042624 | Bacteria | 1124 |
| 68 | Ga0466702_031065 | 3300042635 | Bacteria | 1646 |
| 69 | Ga0466709_005098 | 3300042648 | Bacteria | 3104 |
| 70 | Ga0466732_231028 | 3300042656 | Bacteria | 5503 |
| 71 | AustNasuHG_c1004509 | 3300000089 | Bacteria | 4994 |
| 72 | JGI24698J34947_10020504 | 3300002449 | Unclassified | 3559 |
| 73 | JGI24698J34947_10033805 | 3300002449 | Bacteria | 2680 |
| 74 | JGI24698J34947_10067230 | 3300002449 | Bacteria | 1740 |
| 75 | JGI24695J34938_10000846 | 3300002450 | Bacteria | 28385 |
| 76 | JGI24695J34938_10001505 | 3300002450 | Bacteria | 19660 |
| 77 | JGI24695J34938_10032632 | 3300002450 | Bacteria | 2404 |
| 78 | JGI24695J34938_10055447 | 3300002450 | Bacteria | 1713 |
| 79 | Ga0072941_1003496 | 3300005201 | Bacteria | 48417 |
| 80 | Ga0074263_109348 | 3300005485 | Bacteria | 2546 |
| 81 | Ga0074263_111690 | 3300005485 | Bacteria | 1420 |
| 82 | Ga0466694_001320 | 3300042594 | Unclassified | 3404 |
| 83 | Ga0466694_058208 | 3300042594 | Bacteria | 4388 |
| 84 | Ga0466699_040245 | 3300042597 | Bacteria | 16388 |
| 85 | Ga0466699_362055 | 3300042597 | Bacteria | 1269 |
| 86 | Ga0466699_366234 | 3300042597 | Bacteria | 2059 |
| 87 | Ga0123356_10041991 | 3300010049 | Bacteria | 4262 |
| 88 | Ga0123356_10043329 | 3300010049 | Unclassified | 4190 |
| 89 | Ga0123356_10267506 | 3300010049 | Bacteria | 1797 |
| 90 | Ga0466700_304093 | 3300042600 | Bacteria | 1171 |
| 91 | Ga0466720_027597 | 3300042607 | Unclassified | 8335 |
| 92 | Ga0466720_151197 | 3300042607 | Bacteria | 4319 |
| 93 | Ga0466720_190314 | 3300042607 | Bacteria | 1904 |
| 94 | Ga0466722_125517 | 3300042609 | Bacteria | 16347 |
| 95 | Ga0466712_182921 | 3300042614 | Bacteria | 14856 |
| 96 | Ga0466712_247024 | 3300042614 | Bacteria | 5128 |
| 97 | Ga0466712_267067 | 3300042614 | Bacteria | 18400 |
| 98 | Ga0466718_005051 | 3300042617 | Bacteria | 7908 |
| 99 | Ga0466726_199764 | 3300042619 | Bacteria | 3903 |
| 100 | Ga0466728_149357 | 3300042620 | Bacteria | 2041 |
| 101 | Ga0466705_244136 | 3300042612 | Bacteria | 34469 |
| 102 | Ga0466702_191139 | 3300042635 | Bacteria | 1813 |
| 103 | JGI24695J34938_10000023 | 3300002450 | Bacteria | 110103 |
| 104 | JGI24695J34938_10000132 | 3300002450 | Bacteria | 67814 |
| 105 | JGI24695J34938_10006987 | 3300002450 | Bacteria | 6690 |
| 106 | JGI24695J34938_10009019 | 3300002450 | Bacteria | 5601 |
| 107 | JGI24695J34938_10042030 | 3300002450 | Unclassified | 2049 |
| 108 | Ga0415639_085510 | 3300038395 | Bacteria | 1455 |
| 109 | Ga0415639_124500 | 3300038395 | Bacteria | 982 |
| 110 | Ga0466694_005723 | 3300042594 | Bacteria | 2327 |
| 111 | Ga0466694_169334 | 3300042594 | Bacteria | 25063 |
| 112 | Ga0466694_231407 | 3300042594 | Unclassified | 1209 |
| 113 | Ga0466694_344653 | 3300042594 | Bacteria | 1097 |
| 114 | Ga0466699_121698 | 3300042597 | Bacteria | 5294 |
| 115 | Ga0466699_170061 | 3300042597 | Bacteria | 2619 |
| 116 | Ga0466699_343227 | 3300042597 | Bacteria | 1348 |
| 117 | Ga0123353_10246691 | 3300010167 | Bacteria | 2770 |
| 118 | Ga0466719_290312 | 3300042606 | Bacteria | 4206 |
| 119 | Ga0466721_054531 | 3300042608 | Bacteria | 1292 |
| 120 | Ga0466718_014408 | 3300042617 | Bacteria | 2806 |
| 121 | Ga0466718_084958 | 3300042617 | Bacteria | 3023 |
| 122 | Ga0466718_153178 | 3300042617 | Bacteria | 1425 |
| 123 | Ga0466731_138232 | 3300042622 | Bacteria | 2422 |
| 124 | Ga0466702_102256 | 3300042635 | Bacteria | 8959 |
| 125 | Ga0466704_301502 | 3300042643 | Bacteria | 29784 |
| 126 | Ga0466704_347135 | 3300042643 | Bacteria | 20726 |
| 127 | Ga0466704_399333 | 3300042643 | Bacteria | 11748 |
| 128 | Ga0466727_206282 | 3300042655 | Bacteria | 3670 |
| 129 | Nasutiter_Contig04500 | 2030936001 | Unclassified | 3798 |
| 130 | AustNasuHG_c1001690 | 3300000089 | Bacteria | 7970 |
| 131 | AustNasuHG_c1008355 | 3300000089 | Bacteria | 3668 |
| 132 | JGI24695J34938_10000423 | 3300002450 | Bacteria | 40993 |
| 133 | JGI24695J34938_10001598 | 3300002450 | Bacteria | 19063 |
| 134 | JGI24695J34938_10002974 | 3300002450 | Bacteria | 12214 |
| 135 | JGI24695J34938_10133750 | 3300002450 | Unclassified | 1011 |
| 136 | Ga0264413_100302 | 3300024493 | Bacteria | 69754 |
| 137 | Ga0264413_105957 | 3300024493 | Unclassified | 4126 |
| 138 | Ga0466692_188500 | 3300042591 | Bacteria | 54661 |
| 139 | Ga0466693_024216 | 3300042592 | Bacteria | 11454 |
| 140 | Ga0466693_348000 | 3300042592 | Unclassified | 3230 |
| 141 | Ga0466691_137669 | 3300042593 | Unclassified | 7264 |
| 142 | Ga0466694_113938 | 3300042594 | Unclassified | 1147 |
| 143 | Ga0466699_116539 | 3300042597 | Bacteria | 3432 |
| 144 | Ga0466699_143336 | 3300042597 | Bacteria | 14459 |
| 145 | Ga0466699_410770 | 3300042597 | Unclassified | 1433 |
| 146 | Ga0123356_10002029 | 3300010049 | Bacteria | 21869 |
| 147 | Ga0123356_10377916 | 3300010049 | Bacteria | 1548 |
| 148 | Ga0123353_10619621 | 3300010167 | Bacteria | 1541 |
| 149 | Ga0466700_167542 | 3300042600 | Bacteria | 2056 |
| 150 | Ga0466700_237347 | 3300042600 | Bacteria | 16561 |
| 151 | Ga0466717_077148 | 3300042604 | Bacteria | 3520 |
| 152 | Ga0466720_022984 | 3300042607 | Unclassified | 1573 |
| 153 | Ga0466720_038394 | 3300042607 | Unclassified | 3242 |
| 154 | Ga0466712_186432 | 3300042614 | Unclassified | 2503 |
| 155 | Ga0466711_040360 | 3300042615 | Bacteria | 9484 |
| 156 | Ga0466718_004895 | 3300042617 | Bacteria | 1618 |
| 157 | Ga0466718_035532 | 3300042617 | Bacteria | 3040 |
| 158 | Ga0466726_383540 | 3300042619 | Bacteria | 4038 |
| 159 | AustNasuHG_c1013585 | 3300000089 | Bacteria | 2789 |
| 160 | AustNasuHG_c1013835 | 3300000089 | Unclassified | 2758 |
| 161 | JGI24698J34947_10084431 | 3300002449 | Unclassified | 1479 |
| 162 | JGI24695J34938_10004169 | 3300002450 | Bacteria | 9619 |
| 163 | JGI24695J34938_10019913 | 3300002450 | Bacteria | 3312 |
| 164 | JGI24695J34938_10019964 | 3300002450 | Bacteria | 3308 |
| 165 | JGI24697J35500_11190167 | 3300002507 | Bacteria | 1582 |
| 166 | Ga0255809_1004080 | 3300022820 | Bacteria | 2394 |
| 167 | Ga0264413_103318 | 3300024493 | Bacteria | 11748 |
| 168 | Ga0466690_184597 | 3300042590 | Unclassified | 2754 |
| 169 | Ga0466693_121705 | 3300042592 | Bacteria | 24410 |
| 170 | Ga0466694_095891 | 3300042594 | Bacteria | 9508 |
| 171 | Ga0466699_029940 | 3300042597 | Bacteria | 18442 |
| 172 | Ga0466699_041575 | 3300042597 | Bacteria | 4127 |
| 173 | Ga0466699_104563 | 3300042597 | Bacteria | 1751 |
| 174 | Ga0123356_10001798 | 3300010049 | Bacteria | 23357 |
| 175 | Ga0123356_10002989 | 3300010049 | Bacteria | 17873 |
| 176 | Ga0123356_10023281 | 3300010049 | Unclassified | 5830 |
| 177 | Ga0123356_10310458 | 3300010049 | Bacteria | 1686 |
| 178 | Ga0466717_038058 | 3300042604 | Bacteria | 2283 |
| 179 | Ga0466720_025542 | 3300042607 | Bacteria | 24900 |
| 180 | Ga0466720_099903 | 3300042607 | Bacteria | 25510 |
| 181 | Ga0466720_107313 | 3300042607 | Bacteria | 24749 |
| 182 | Ga0466711_298710 | 3300042615 | Bacteria | 1191 |
| 183 | Ga0466718_038774 | 3300042617 | Bacteria | 2946 |
| 184 | Ga0466718_164469 | 3300042617 | Unclassified | 1650 |
| 185 | Ga0466726_433516 | 3300042619 | Bacteria | 2477 |
| 186 | Ga0466731_039547 | 3300042622 | Bacteria | 7156 |
| 187 | Ga0466735_198086 | 3300042624 | Bacteria | 1480 |
| 188 | AustNasuHG_c1005920 | 3300000089 | Bacteria | 4370 |
| 189 | AustNasuHG_c1043343 | 3300000089 | Bacteria | 1057 |
| 190 | JGI24698J34947_10001602 | 3300002449 | Bacteria | 12030 |
| 191 | JGI24698J34947_10019725 | 3300002449 | Unclassified | 3633 |
| 192 | JGI24698J34947_10025414 | 3300002449 | Bacteria | 3152 |
| 193 | JGI24698J34947_10052039 | 3300002449 | Bacteria | 2057 |
| 194 | JGI24698J34947_10086268 | 3300002449 | Bacteria | 1455 |
| 195 | JGI24695J34938_10000017 | 3300002450 | Bacteria | 115659 |
| 196 | JGI24695J34938_10000140 | 3300002450 | Bacteria | 65738 |
| 197 | JGI24695J34938_10002359 | 3300002450 | Bacteria | 14531 |
| 198 | JGI24695J34938_10016162 | 3300002450 | Bacteria | 3807 |
| 199 | Ga0072940_1011852 | 3300005200 | Bacteria | 1443 |
| 200 | Ga0072941_1001351 | 3300005201 | Bacteria | 33692 |
| 201 | Ga0072941_1005007 | 3300005201 | Bacteria | 26558 |
| 202 | Ga0466694_296948 | 3300042594 | Bacteria | 1422 |
| 203 | Ga0466695_358634 | 3300042595 | Bacteria | 6868 |
| 204 | Ga0466699_014807 | 3300042597 | Bacteria | 3734 |
| 205 | Ga0466699_048065 | 3300042597 | Bacteria | 4121 |
| 206 | Ga0123356_10045871 | 3300010049 | Bacteria | 4066 |
| 207 | Ga0123356_10056924 | 3300010049 | Unclassified | 3643 |
| 208 | Ga0466700_483586 | 3300042600 | Bacteria | 1783 |
| 209 | Ga0466722_108928 | 3300042609 | Bacteria | 8806 |
| 210 | Ga0466698_207415 | 3300042610 | Bacteria | 1854 |
| 211 | Ga0466712_280427 | 3300042614 | Bacteria | 22844 |
| 212 | Ga0466718_002747 | 3300042617 | Unclassified | 2389 |
| 213 | Ga0466718_004450 | 3300042617 | Bacteria | 11933 |
| 214 | Ga0466718_013068 | 3300042617 | Bacteria | 9447 |
| 215 | Ga0466726_206638 | 3300042619 | Bacteria | 1594 |
| 216 | Ga0466702_064918 | 3300042635 | Bacteria | 17367 |
| 217 | Ga0466703_321048 | 3300042636 | Bacteria | 44056 |
| 218 | JGI24698J34947_10004501 | 3300002449 | Bacteria | 7583 |
| 219 | JGI24698J34947_10031208 | 3300002449 | Bacteria | 2807 |
| 220 | JGI24698J34947_10044277 | 3300002449 | Bacteria | 2279 |
| 221 | JGI24695J34938_10000294 | 3300002450 | Bacteria | 49200 |
| 222 | JGI24695J34938_10000597 | 3300002450 | Bacteria | 34739 |
| 223 | JGI24695J34938_10006818 | 3300002450 | Bacteria | 6779 |
| 224 | JGI24699J35502_11123750 | 3300002509 | Unclassified | 3584 |
| 225 | Ga0072941_1092904 | 3300005201 | Bacteria | 4424 |
| 226 | Ga0074263_107535 | 3300005485 | Bacteria | 3928 |
| 227 | Ga0415639_018180 | 3300038395 | Bacteria | 3859 |
| 228 | Ga0466694_020643 | 3300042594 | Bacteria | 11990 |
| 229 | Ga0466694_254810 | 3300042594 | Bacteria | 2135 |
| 230 | Ga0466699_001211 | 3300042597 | Bacteria | 1289 |
| 231 | Ga0466699_119978 | 3300042597 | Bacteria | 26184 |
| 232 | Ga0466699_180071 | 3300042597 | Unclassified | 1219 |
| 233 | Ga0123356_10002877 | 3300010049 | Bacteria | 18216 |
| 234 | Ga0123356_10068547 | 3300010049 | Bacteria | 3323 |
| 235 | Ga0123356_10910993 | 3300010049 | Bacteria | 1050 |
| 236 | Ga0123356_11132888 | 3300010049 | Bacteria | 950 |
| 237 | Ga0466700_069463 | 3300042600 | Bacteria | 1284 |
| 238 | Ga0466716_007905 | 3300042605 | Bacteria | 3858 |
| 239 | Ga0466720_210143 | 3300042607 | Unclassified | 5115 |
| 240 | Ga0466720_233451 | 3300042607 | Unclassified | 2369 |
| 241 | Ga0466721_271808 | 3300042608 | Bacteria | 1232 |
| 242 | Ga0466712_094655 | 3300042614 | Unclassified | 1628 |
| 243 | Ga0466712_177213 | 3300042614 | Bacteria | 1370 |
| 244 | Ga0466711_289442 | 3300042615 | Bacteria | 1318 |
| 245 | Ga0466718_049849 | 3300042617 | Bacteria | 1755 |
| 246 | Ga0466731_146613 | 3300042622 | Bacteria | 26612 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00121 | TIM | Triosephosphate isomerase | 4 | 248 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00121 | GO:0004807 | triose-phosphate isomerase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.