Protein Family IF06135

Metagenome Isolate
199 Members
133 Samples
99 Scaffolds
507.75 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_121888|Ga0466713_121888_269_1864
Length
531 aa
Sequence
MIGGEDIASGVSGVYGVNDATGQDRAYLARNSLHAYLPGENKDLLPKDTRPLLERIKSRSKIVPSLEEAVRLSGLRDGMTVSFHHHFRNGDNIVNPVLDTLARMGFRNLRVAASSLNDVHEPMIGHIRAGVVDRIETSGLRGGLAEAVSRGLMAEPVVFRSHGGRAAAIQNGALHIDVAFLGAPSCDPYGNVNGYSREGQDHSACGSMGYARVDAQFADKVVALTDNIVPYPNTPFGIPQSQVDYIVEVDSVGEQAKIMTGATRQTKNPRDLLIAEKAAEVVIHSGYFVDGFSIQTGSGGAALAVTRFIRDEMAGRGVRASFALGGITGQIVRLHEEGLIKKLLDVQSFDVDAVESLKNNRFHQQIDANYYANPYNKGSAVNELDVVVLSALEIDENFNVNVLTGSDGVIRGAIGGHQDTAAGAALSVLVGPLVRGRIPTVLRRVNTVVTPGDTVDVFVSDQGCAVNPRRPEVAARLARAGVDVYTMDELRRKAERMTGEPDPLPFGDKVVGVVTYRDGSVLDLIYDVRDS

📊 Sample Types

Isolate 50.2%
Metagenome 49.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.9%
Apidae 25.8%
Drosophilidae 15.6%
Kalotermitidae 11.7%
Termitidae 3.9%
Culicidae 3.9%
Termopsidae 2.3%
Rhinotermitidae 1.6%
Passalidae 1.6%
Vespidae 0.8%
Bombycidae 0.8%
Hodotermitidae 0.8%
Pyrrhocoridae 0.8%
Hydrophilidae 0.8%
Tenebrionidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 191
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
2 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
3 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
4 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
5 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
6 3004719924 Lactobacillus sp. W8174 Isolate Apidae
7 2595698199 Melissococcus plutonius 60 Isolate Apidae
8 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
9 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
10 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
11 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
12 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
13 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
14 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
19 8017489919 Lactobacillus brevis EF Isolate Unclassified
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
24 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
25 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
26 2964145936 Entomospira culicis BR149 Isolate Culicidae
27 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
28 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
29 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
30 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
31 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
32 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
35 2595698193 Melissococcus plutonius B5 Isolate Apidae
36 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
37 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
38 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
39 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
40 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
43 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
44 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
49 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
50 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
51 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
52 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
53 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
54 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
55 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
56 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
57 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
58 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
59 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
60 8114555646 Enterococcus sp. DIV1094 Isolate
61 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
62 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
63 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
64 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
65 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
66 2627853628 Melissococcus plutonius 82 Isolate Apidae
67 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
68 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
69 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
70 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
71 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
72 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
73 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
74 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
75 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
76 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
77 2558860239 Spiroplasma culicicola AES-1 Isolate Culicidae
78 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
79 8063597228 Entomospira culicis BR151 Isolate Culicidae
80 8108568626 Enterococcus sp. DIV1094 Isolate
81 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
82 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
83 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
84 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
85 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
86 2964144231 Entomospira culicis BR151 Isolate Culicidae
87 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
88 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
89 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
90 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
91 2595698195 Melissococcus plutonius 119 Isolate Apidae
92 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
93 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
94 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
95 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
96 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
97 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
98 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
99 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
100 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
101 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
102 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
103 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
104 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
105 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
106 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
107 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
108 2595698197 Melissococcus plutonius H6 Isolate Apidae
109 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
110 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
111 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
112 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
113 8063595521 Entomospira culicis BR149 Isolate Culicidae
114 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
115 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
116 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
117 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
118 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
119 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
120 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
121 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
122 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
123 2595698198 Melissococcus plutonius L9 Isolate Apidae
124 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
125 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
126 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
127 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
128 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
129 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
130 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
131 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
132 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
133 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_097527 3300042612 Bacteria 3972
2 Ga0562379_0011 3300056790 Bacteria 1623141
3 Ga0466711_236971 3300042615 Bacteria 16778
4 Ga0466723_141990 3300042618 Unclassified 6767
5 Ga0466703_179720 3300042636 Bacteria 3896
6 Ga0466703_360167 3300042636 Bacteria 4354
7 Ga0466704_050841 3300042643 Bacteria 2764
8 Ga0466704_168208 3300042643 Bacteria 28884
9 Ga0466708_026639 3300042652 Bacteria 11263
10 Ga0466708_160348 3300042652 Bacteria 7764
11 Ga0466691_153370 3300042593 Bacteria 12863
12 Ga0466706_038590 3300042599 Bacteria 35108
13 Ga0466700_095378 3300042600 Bacteria 87403
14 Ga0466713_121888 3300042602 Bacteria 4587
15 Ga0466719_112665 3300042606 Bacteria 44651
16 Ga0466719_178424 3300042606 Bacteria 1853
17 2227463829 2225789004 Bacteria 5292
18 IMNBL1DRAFT_c0003046 3300000062 Bacteria 11065
19 Ga0466705_204125 3300042612 Bacteria 12824
20 Ga0466705_318713 3300042612 Unclassified 2012
21 Ga0466711_134598 3300042615 Bacteria 10753
22 Ga0466715_533916 3300042616 Bacteria 24126
23 Ga0466726_014016 3300042619 Bacteria 2329
24 Ga0466703_173516 3300042636 Bacteria 3474
25 Ga0466704_489140 3300042643 Bacteria 9974
26 Ga0466704_528612 3300042643 Bacteria 5448
27 Ga0466709_121017 3300042648 Bacteria 2518
28 Ga0466727_238638 3300042655 Unclassified 2174
29 Ga0466690_196149 3300042590 Bacteria 27057
30 Ga0466696_177692 3300042596 Bacteria 5179
31 2227591284 2225789004 Bacteria 48103
32 IMNBL1DRAFT_c0017592 3300000062 Bacteria 3002
33 Ga0074278_119844 3300005721 Unclassified 8334
34 Ga0074278_142236 3300005721 Bacteria 46389
35 Ga0466715_408870 3300042616 Bacteria 12544
36 Ga0466715_510871 3300042616 Bacteria 6762
37 Ga0466723_113123 3300042618 Bacteria 12537
38 Ga0466726_401888 3300042619 Bacteria 18079
39 Ga0466728_034112 3300042620 Bacteria 27725
40 Ga0466704_084651 3300042643 Bacteria 24091
41 Ga0466704_441158 3300042643 Bacteria 10702
42 Ga0466704_544874 3300042643 Bacteria 5202
43 Ga0466692_070667 3300042591 Bacteria 3161
44 Ga0466707_010078 3300042601 Bacteria 2927
45 Ga0466716_084409 3300042605 Bacteria 10346
46 Ga0466719_566348 3300042606 Bacteria 4658
47 Ga0068305_10064205 3300005083 Bacteria 3119
48 Ga0466705_192553 3300042612 Unclassified 2882
49 Ga0466723_005889 3300042618 Bacteria 5667
50 Ga0466723_039096 3300042618 Bacteria 7654
51 Ga0466728_086008 3300042620 Bacteria 6421
52 Ga0123353_10292783 3300010167 Bacteria 2491
53 Ga0466709_181411 3300042648 Bacteria 2801
54 Ga0466708_203793 3300042652 Bacteria 10598
55 Ga0466708_217874 3300042652 Bacteria 5135
56 Ga0466727_174131 3300042655 Bacteria 11843
57 Ga0466690_408750 3300042590 Bacteria 2342
58 Ga0466691_087208 3300042593 Bacteria 7646
59 Ga0466696_256157 3300042596 Bacteria 36381
60 Ga0466719_162096 3300042606 Bacteria 14272
61 HBC_ctgsDRAFT_1000128 3300000333 Bacteria 18614
62 Ga0466726_159671 3300042619 Bacteria 3477
63 Ga0466728_137448 3300042620 Bacteria 10677
64 Ga0466735_020407 3300042624 Unclassified 8027
65 Ga0466690_045159 3300042590 Bacteria 6795
66 Ga0466691_136277 3300042593 Bacteria 5664
67 Ga0466719_275760 3300042606 Bacteria 8100
68 IMNBL1DRAFT_c0000405 3300000062 Bacteria 36558
69 Ga0466705_027160 3300042612 Bacteria 4396
70 Ga0466705_266488 3300042612 Bacteria 6915
71 Ga0466715_115730 3300042616 Bacteria 8275
72 Ga0466715_213975 3300042616 Bacteria 22156
73 Ga0466704_080029 3300042643 Bacteria 18024
74 Ga0466704_204150 3300042643 Bacteria 13724
75 Ga0466706_046447 3300042599 Unclassified 1455
76 Ga0466707_348765 3300042601 Bacteria 5377
77 Ga0466714_161318 3300042603 Bacteria 3202
78 Ga0466705_149154 3300042612 Bacteria 4648
79 Ga0466733_074647 3300042659 Bacteria 10950
80 Ga0466711_095116 3300042615 Bacteria 15490
81 Ga0466715_334969 3300042616 Bacteria 10133
82 Ga0466728_205127 3300042620 Bacteria 3665
83 Ga0466734_019259 3300042623 Bacteria 11227
84 Ga0466708_303285 3300042652 Bacteria 18072
85 Ga0466696_109442 3300042596 Bacteria 7513
86 Ga0466714_089617 3300042603 Bacteria 1891
87 Ga0466719_398592 3300042606 Bacteria 7898
88 Ga0466722_080785 3300042609 Bacteria 2158
89 Ga0466722_126134 3300042609 Bacteria 12087
90 HBC_ctgsDRAFT_1000633 3300000333 Unclassified 7789
91 Ga0466705_163372 3300042612 Bacteria 5354
92 Ga0466733_167157 3300042659 Bacteria 20372
93 Ga0466711_253371 3300042615 Bacteria 3457
94 Ga0466715_229423 3300042616 Bacteria 5672
95 Ga0466723_233626 3300042618 Bacteria 17477
96 Ga0466703_233480 3300042636 Bacteria 8622
97 Ga0466690_376828 3300042590 Bacteria 3979
98 Ga0466692_035955 3300042591 Bacteria 4207
99 Ga0466722_065491 3300042609 Bacteria 8979

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04223 CitF Citrate lyase, alpha subunit (CitF) 61 528 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.