Protein Family IF06112

Metagenome Isolate
126 Members
70 Samples
91 Scaffolds
176.02 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_099712|Ga0466713_099712_26670_27248
Length
192 aa
Sequence
MGVNPIPASPSQPLPSKSGQELISSLIRDVPDFPKPGVVFKDITPLLSDPTGFKAAVDALAATAPDGIDVVMGMEARGFIFAAPVAIALGAGFVPVRKPGKLPGDVYSETFALEYGEETLSVKTDAVIPGSRVMVIDDVLATGGTIGATAELVKKLGAELVHVAVLMELSFLGGRKYLAEHGVNECSAILTV

📊 Sample Types

Isolate 27.8%
Metagenome 72.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.3%
Unclassified 31.3%
Kalotermitidae 14.9%
Formicidae 4.5%
Rhinotermitidae 1.5%
Curculionidae 1.5%
Hydrophilidae 1.5%
Thomisidae 1.5%
Passalidae 1.5%
Hodotermitidae 1.5%
Siricidae 1.5%
Termopsidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 2896955351 Streptomyces sp. GF20 Isolate Termitidae
8 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
9 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
15 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
16 8073544309 Actinomadura sp. RB99 Isolate Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2912749649 Streptomyces sp. GS7 Isolate Termitidae
21 3006461590 Streptomyces sp. RB5 Isolate Termitidae
22 3006667155 Streptomyces sp. SID9727 Isolate
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
25 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
26 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
27 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
28 2828505942 Spirobacillus cienkowskii binning01 Isolate Unclassified
29 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
30 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
31 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
35 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
36 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
45 2862784999 Streptomyces sp. M41 Isolate Unclassified
46 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
47 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
48 2820176377 Unclassified Planctomycetes Th196P3bin111 Isolate Unclassified
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
51 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
52 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
53 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
58 2547132081 Streptomyces sp. S4 Isolate Formicidae
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
60 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
61 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
62 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
63 2908241010 Streptomyces sp. HF10 Isolate Termitidae
64 2912817845 Streptomyces griseus SID164 Isolate
65 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
66 3006468911 Streptomyces sp. RB17 Isolate Termitidae
67 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
68 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
69 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
70 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_042113 3300042612 Bacteria 29459
2 Ga0123357_10644531 3300009784 Bacteria 788
3 Ga0123356_10148799 3300010049 Bacteria 2321
4 Ga0123353_10504558 3300010167 Bacteria 1761
5 Ga0466713_036909 3300042602 Unclassified 2643
6 Ga0466713_101616 3300042602 Bacteria 503322
7 Ga0466716_368889 3300042605 Unclassified 1232
8 JGI24699J35502_11124154 3300002509 Bacteria 3632
9 Ga0466702_117677 3300042635 Bacteria 1931
10 Ga0466733_095232 3300042659 Bacteria 1150
11 Ga0466715_388771 3300042616 Bacteria 11144
12 Ga0466718_052295 3300042617 Bacteria 24414
13 Ga0123357_10315129 3300009784 Bacteria 1555
14 Ga0123357_10406708 3300009784 Bacteria 1232
15 Ga0123355_10000081 3300009826 Bacteria 101187
16 Ga0123356_10047052 3300010049 Bacteria 4014
17 Ga0123354_10031629 3300010882 Bacteria 8299
18 Ga0123354_10358912 3300010882 Bacteria 1287
19 Ga0466707_162369 3300042601 Bacteria 46084
20 Ga0466707_275153 3300042601 Bacteria 4018
21 Ga0466713_060052 3300042602 Bacteria 31034
22 Ga0466717_305503 3300042604 Bacteria 1161
23 JGI24699J35502_11127154 3300002509 Bacteria 4098
24 JGI24699J35502_11134198 3300002509 Bacteria 53560
25 Ga0466690_013679 3300042590 Bacteria 17357
26 Ga0466708_237352 3300042652 Bacteria 4508
27 Ga0466733_130751 3300042659 Bacteria 17740
28 Ga0466726_239137 3300042619 Bacteria 1525
29 Ga0123357_10100733 3300009784 Bacteria 3726
30 Ga0123357_10125628 3300009784 Bacteria 3215
31 Ga0123353_10017077 3300010167 Bacteria 10642
32 Ga0123354_10220392 3300010882 Bacteria 2018
33 Ga0466707_096478 3300042601 Bacteria 14566
34 Ga0466713_111627 3300042602 Bacteria 3245
35 JGI24699J35502_11133413 3300002509 Bacteria 10397
36 Ga0072941_1041812 3300005201 Bacteria 42390
37 Ga0466696_204899 3300042596 Bacteria 30341
38 Ga0466729_203517 3300042621 Bacteria 4314
39 Ga0466730_019200 3300042625 Bacteria 17181
40 Ga0466723_172941 3300042618 Bacteria 8903
41 Ga0466729_148867 3300042621 Bacteria 7926
42 Ga0123357_10352968 3300009784 Bacteria 1404
43 Ga0123356_10085068 3300010049 Bacteria 2999
44 Ga0123356_11637683 3300010049 Bacteria 797
45 Ga0123354_10006239 3300010882 Bacteria 17649
46 Ga0466713_099015 3300042602 Bacteria 104926
47 IMNBGM34_c000035 3300000036 Bacteria 37086
48 IMNBGM34_c001087 3300000036 Bacteria 5371
49 Ga0466696_482796 3300042596 Bacteria 1001
50 Ga0466730_012942 3300042625 Bacteria 26476
51 Ga0466725_138459 3300042654 Bacteria 7190
52 Ga0466723_221696 3300042618 Bacteria 12497
53 Ga0123357_10008430 3300009784 Bacteria 12871
54 Ga0123353_10501974 3300010167 Bacteria 1767
55 Ga0123354_10035921 3300010882 Unclassified 7735
56 Ga0123354_10186481 3300010882 Bacteria 2344
57 Ga0466707_087864 3300042601 Bacteria 54590
58 Ga0466713_004754 3300042602 Bacteria 139596
59 Ga0466713_099712 3300042602 Bacteria 35885
60 Ga0466726_306513 3300042619 Bacteria 11966
61 Ga0123356_11113820 3300010049 Bacteria 957
62 Ga0123354_10000354 3300010882 Bacteria 43156
63 Ga0123354_10033621 3300010882 Bacteria 8025
64 Ga0123354_10532033 3300010882 Bacteria 897
65 Ga0466706_212949 3300042599 Bacteria 2286
66 Ga0466713_012194 3300042602 Bacteria 5256
67 Ga0466698_439367 3300042610 Bacteria 1174
68 JGI24695J34938_10110837 3300002450 Bacteria 1118
69 Ga0466693_175073 3300042592 Bacteria 99322
70 Ga0466733_102585 3300042659 Bacteria 133807
71 Ga0466715_075973 3300042616 Bacteria 23146
72 Ga0466715_417065 3300042616 Bacteria 8483
73 Ga0123353_11693282 3300010167 Unclassified 792
74 Ga0123354_10009688 3300010882 Bacteria 14790
75 Ga0123354_10035944 3300010882 Bacteria 7732
76 Ga0123354_10074569 3300010882 Bacteria 4860
77 Ga0466713_119651 3300042602 Bacteria 11299
78 Ga0466719_248554 3300042606 Unclassified 2757
79 Ga0415639_050069 3300038395 Bacteria 10738
80 Ga0466704_078371 3300042643 Bacteria 4968
81 Ga0466704_420081 3300042643 Bacteria 33099
82 Ga0466733_133508 3300042659 Bacteria 1327
83 Ga0123353_11393068 3300010167 Bacteria 902
84 Ga0466713_061290 3300042602 Bacteria 1955
85 Ga0466714_134303 3300042603 Bacteria 2463
86 Ga0466719_289577 3300042606 Bacteria 3167
87 JGI24695J34938_10003787 3300002450 Bacteria 10300
88 JGI24695J34938_10035287 3300002450 Bacteria 2288
89 JGI24699J35502_10839698 3300002509 Unclassified 937
90 Ga0466691_162786 3300042593 Bacteria 7714
91 Ga0466695_005096 3300042595 Bacteria 1092

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10033621 Ga0123354_100336212 145
2 3300010882 Ga0123354_10031629 Ga0123354_100316296 156
3 3300042605 Ga0466716_368889 Ga0466716_368889_621_1142 160
4 3300042602 Ga0466713_119651 Ga0466713_119651_6723_7262 166
5 3300038395 Ga0415639_050069 Ga0415639_050069_4034_4537 167
6 3300042599 Ga0466706_212949 Ga0466706_212949_1602_2135 167
7 3300042643 Ga0466704_078371 Ga0466704_078371_1490_2008 167
8 3300010167 Ga0123353_11693282 Ga0123353_116932821 168
9 3300042617 Ga0466718_052295 Ga0466718_052295_21458_21967 169
10 3300042635 Ga0466702_117677 Ga0466702_117677_1103_1612 169
11 iso_pr_bacteria 2773857779 2774478588 169
12 iso_pr_bacteria 2778260937 2778348709 169
13 3300002450 JGI24695J34938_10003787 JGI24695J34938_100037878 170
14 3300002450 JGI24695J34938_10035287 JGI24695J34938_100352871 170
15 3300002450 JGI24695J34938_10110837 JGI24695J34938_101108372 170
16 3300005201 Ga0072941_1041812 Ga0072941_104181249 170
17 3300010049 Ga0123356_10148799 Ga0123356_101487992 170
18 3300010882 Ga0123354_10006239 Ga0123354_100062395 170
19 iso_pr_bacteria 2820596822 2820596828 170
20 3300009826 Ga0123355_10000081 Ga0123355_100000817 171
21 3300010049 Ga0123356_11637683 Ga0123356_116376831 171
22 3300042601 Ga0466707_087864 Ga0466707_087864_43018_43533 171
23 3300009784 Ga0123357_10100733 Ga0123357_101007334 172
24 3300010882 Ga0123354_10186481 Ga0123354_101864814 172
25 3300010882 Ga0123354_10358912 Ga0123354_103589122 172
26 3300042590 Ga0466690_013679 Ga0466690_013679_16015_16533 172
27 3300042593 Ga0466691_162786 Ga0466691_162786_6481_6999 172
28 3300042606 Ga0466719_289577 Ga0466719_289577_443_961 172
29 3300042618 Ga0466723_221696 Ga0466723_221696_3718_4236 172
30 3300042619 Ga0466726_239137 Ga0466726_239137_240_758 172
31 3300042619 Ga0466726_306513 Ga0466726_306513_1267_1785 172
32 3300042621 Ga0466729_203517 Ga0466729_203517_755_1273 172
33 3300042643 Ga0466704_420081 Ga0466704_420081_27761_28279 172
34 3300042652 Ga0466708_237352 Ga0466708_237352_2269_2787 172
35 iso_pr_bacteria 2820854745 2820856293 172
36 3300010167 Ga0123353_10017077 Ga0123353_100170778 173
37 3300042603 Ga0466714_134303 Ga0466714_134303_1043_1564 173
38 3300042604 Ga0466717_305503 Ga0466717_305503_370_891 173
39 3300042616 Ga0466715_075973 Ga0466715_075973_13964_14485 173
40 3300042616 Ga0466715_388771 Ga0466715_388771_4274_4795 173
41 3300042616 Ga0466715_417065 Ga0466715_417065_4574_5095 173
42 3300042659 Ga0466733_095232 Ga0466733_095232_59_580 173
43 iso_pr_bacteria 2820176377 2820176881 173
44 3300000036 IMNBGM34_c000035 IMNBGM34_00003515 174
45 3300010882 Ga0123354_10000354 Ga0123354_1000035422 174
46 3300010882 Ga0123354_10074569 Ga0123354_100745694 174
47 3300042595 Ga0466695_005096 Ga0466695_005096_369_893 174
48 3300042601 Ga0466707_162369 Ga0466707_162369_15810_16334 174
49 iso_pr_bacteria 2856652821 2856657268 174
50 iso_pr_bacteria 2898589227 2898597278 174
51 iso_pr_bacteria 8073544309 8073545935 174
52 3300009784 Ga0123357_10644531 Ga0123357_106445311 175
53 3300042596 Ga0466696_204899 Ga0466696_204899_24353_24880 175
54 3300042596 Ga0466696_482796 Ga0466696_482796_69_596 175
55 3300009784 Ga0123357_10406708 Ga0123357_104067083 176
56 3300010882 Ga0123354_10532033 Ga0123354_105320332 176
57 3300042602 Ga0466713_099015 Ga0466713_099015_32582_33112 176
58 3300042618 Ga0466723_172941 Ga0466723_172941_864_1394 176
59 iso_pr_bacteria 2630969010 2634124694 176
60 iso_pr_bacteria 2841175817 2841177903 176
61 3300000036 IMNBGM34_c001087 IMNBGM34_0010873 177
62 3300009784 Ga0123357_10315129 Ga0123357_103151292 177
63 3300010882 Ga0123354_10009688 Ga0123354_100096885 177
64 3300042602 Ga0466713_012194 Ga0466713_012194_309_842 177
65 3300042602 Ga0466713_036909 Ga0466713_036909_1143_1676 177
66 3300042602 Ga0466713_060052 Ga0466713_060052_5745_6278 177
67 3300042602 Ga0466713_061290 Ga0466713_061290_486_1019 177
68 3300042602 Ga0466713_111627 Ga0466713_111627_1640_2173 177
69 iso_pr_bacteria 2873558832 2873562391 177
70 3300010049 Ga0123356_11113820 Ga0123356_111138201 178
71 iso_pr_bacteria 2828505942 2828507023 178
72 3300042601 Ga0466707_096478 Ga0466707_096478_10706_11245 179
73 3300042601 Ga0466707_275153 Ga0466707_275153_1698_2237 179
74 3300042602 Ga0466713_004754 Ga0466713_004754_73999_74538 179
75 3300042602 Ga0466713_101616 Ga0466713_101616_323263_323802 179
76 3300042606 Ga0466719_248554 Ga0466719_248554_2065_2604 179
77 3300042610 Ga0466698_439367 Ga0466698_439367_121_660 179
78 3300042625 Ga0466730_012942 Ga0466730_012942_18777_19316 179
79 3300042659 Ga0466733_102585 Ga0466733_102585_127966_128505 179
80 iso_pr_bacteria 2547132081 2547291016 179
81 iso_pr_bacteria 2820816657 2820816823 179
82 iso_pr_bacteria 2820820509 2820821169 179
83 iso_pr_bacteria 2862784999 2862791798 179
84 iso_pr_bacteria 2896955351 2896956067 179
85 iso_pr_bacteria 2908241010 2908242413 179
86 iso_pr_bacteria 3006461590 3006466660 179
87 iso_pr_bacteria 8046957834 8046967477 179
88 iso_pr_bacteria 8077783556 8077784212 179
89 3300002509 JGI24699J35502_10839698 JGI24699J35502_108396981 180
90 3300002509 JGI24699J35502_11124154 JGI24699J35502_111241542 180
91 3300002509 JGI24699J35502_11127154 JGI24699J35502_111271543 180
92 3300002509 JGI24699J35502_11133413 JGI24699J35502_111334133 180
93 3300002509 JGI24699J35502_11134198 JGI24699J35502_1113419836 180
94 3300010167 Ga0123353_10504558 Ga0123353_105045582 180
95 3300010167 Ga0123353_11393068 Ga0123353_113930681 180
96 3300042592 Ga0466693_175073 Ga0466693_175073_60072_60614 180
97 3300042612 Ga0466705_042113 Ga0466705_042113_13124_13681 180
98 3300042621 Ga0466729_148867 Ga0466729_148867_7323_7865 180
99 3300042654 Ga0466725_138459 Ga0466725_138459_5677_6219 180
100 3300042659 Ga0466733_130751 Ga0466733_130751_16098_16640 180
101 iso_pr_bacteria 2820834831 2820836309 180
102 iso_pr_bacteria 2820840446 2820841826 180
103 iso_pr_bacteria 2820901319 2820901858 180
104 iso_pr_bacteria 8053361298 8053366153 180
105 3300009784 Ga0123357_10008430 Ga0123357_1000843013 181
106 3300009784 Ga0123357_10125628 Ga0123357_101256282 181
107 3300010882 Ga0123354_10035921 Ga0123354_100359212 181
108 3300010882 Ga0123354_10035944 Ga0123354_100359442 181
109 3300010882 Ga0123354_10220392 Ga0123354_102203922 181
110 3300042659 Ga0466733_133508 Ga0466733_133508_50_598 182
111 iso_pr_bacteria 2515154100 2515556543 182
112 iso_pr_bacteria 2515154106 2515604178 182
113 iso_pr_bacteria 2873196663 2873199662 182
114 iso_pr_bacteria 2912749649 2912752261 182
115 iso_pr_bacteria 3006468911 3006477996 182
116 3300009784 Ga0123357_10352968 Ga0123357_103529682 183
117 3300042625 Ga0466730_019200 Ga0466730_019200_9742_10293 183
118 iso_pr_bacteria 2515154104 2515588699 183
119 iso_pr_bacteria 2912817845 2912820010 183
120 iso_pr_bacteria 3006667155 3006672750 183
121 iso_pr_bacteria 647000328 647328858 183
122 iso_pr_bacteria 2523533511 2523588707 184
123 3300010167 Ga0123353_10501974 Ga0123353_105019742 185
124 3300010049 Ga0123356_10047052 Ga0123356_100470523 190
125 3300010049 Ga0123356_10085068 Ga0123356_100850684 192
126 3300042602 Ga0466713_099712 Ga0466713_099712_26670_27248 192

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00156 Pribosyltran Phosphoribosyl transferase domain 63 168 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.