Protein Family IF06104
Metagenome
Isolate
111
Members
44
Samples
108
Scaffolds
194.32
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_094343|Ga0466713_094343_859_1449
- Length
- 196 aa
- Sequence
- MSLKVKEIFYSLQGEGGRQGEASIFIRLSGCNFKCPFCDTDFSGGDEMTPEAILQTIRAFSCRWIIWTGGEPTLQLTDAILQFFKQAGYRQAIESNGRQRLSALLDYTVVSPKLQYGEDYALRCNPRVDEVRLPIQAGQQIPDIQIFPLAQYYFLSPVFEESLQNTKRNIDYCIEHIMQHPRWRLSVQLHKLVGMK
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.9%
Kalotermitidae
30.2%
Unclassified
11.6%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Passalidae
4.7%
Blattidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
97
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 11 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 12 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 13 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_122802 | 3300042612 | Bacteria | 4581 |
| 2 | Ga0466715_031058 | 3300042616 | Bacteria | 18036 |
| 3 | Ga0466696_156506 | 3300042596 | Bacteria | 11427 |
| 4 | Ga0123357_10034714 | 3300009784 | Bacteria | 6857 |
| 5 | Ga0123356_10726632 | 3300010049 | Unclassified | 1163 |
| 6 | Ga0123353_10864405 | 3300010167 | Archaea | 1237 |
| 7 | Ga0123353_10933363 | 3300010167 | Unclassified | 1176 |
| 8 | Ga0123354_10568519 | 3300010882 | Bacteria | 846 |
| 9 | JGI24699J35502_11133955 | 3300002509 | Bacteria | 21167 |
| 10 | Ga0072941_1142408 | 3300005201 | Bacteria | 1826 |
| 11 | Ga0466735_091112 | 3300042624 | Bacteria | 2146 |
| 12 | Ga0466703_134817 | 3300042636 | Bacteria | 1215 |
| 13 | Ga0466709_275974 | 3300042648 | Bacteria | 6582 |
| 14 | Ga0466727_268437 | 3300042655 | Bacteria | 7860 |
| 15 | Ga0466700_042032 | 3300042600 | Bacteria | 28290 |
| 16 | Ga0466716_024644 | 3300042605 | Bacteria | 13405 |
| 17 | Ga0466722_061682 | 3300042609 | Bacteria | 7102 |
| 18 | Ga0123357_10030404 | 3300009784 | Bacteria | 7320 |
| 19 | Ga0123357_10430952 | 3300009784 | Bacteria | 1165 |
| 20 | Ga0123357_10749256 | 3300009784 | Bacteria | 680 |
| 21 | Ga0123356_11854361 | 3300010049 | Bacteria | 750 |
| 22 | 2227494869 | 2225789004 | Unclassified | 770 |
| 23 | JGI24699J35502_11117858 | 3300002509 | Bacteria | 3058 |
| 24 | Ga0068305_10154915 | 3300005083 | Bacteria | 9014 |
| 25 | Ga0466703_142844 | 3300042636 | Bacteria | 24403 |
| 26 | Ga0466703_206270 | 3300042636 | Bacteria | 10450 |
| 27 | Ga0466707_049922 | 3300042601 | Bacteria | 8653 |
| 28 | Ga0466707_229962 | 3300042601 | Bacteria | 21198 |
| 29 | Ga0466721_208826 | 3300042608 | Unclassified | 1321 |
| 30 | Ga0466722_052506 | 3300042609 | Bacteria | 8388 |
| 31 | Ga0466698_146181 | 3300042610 | Bacteria | 1384 |
| 32 | Ga0466698_389347 | 3300042610 | Bacteria | 1594 |
| 33 | Ga0466705_269196 | 3300042612 | Unclassified | 1190 |
| 34 | Ga0466711_067522 | 3300042615 | Bacteria | 13065 |
| 35 | Ga0466711_180821 | 3300042615 | Bacteria | 1083 |
| 36 | Ga0466726_285482 | 3300042619 | Unclassified | 1252 |
| 37 | Ga0123356_10165946 | 3300010049 | Bacteria | 2212 |
| 38 | 2227175245 | 2225789004 | Bacteria | 8150 |
| 39 | IMNBL1DRAFT_c0002749 | 3300000062 | Bacteria | 11956 |
| 40 | JGI24699J35502_11133981 | 3300002509 | Bacteria | 22510 |
| 41 | Ga0466703_058349 | 3300042636 | Bacteria | 2756 |
| 42 | Ga0466708_069111 | 3300042652 | Bacteria | 9957 |
| 43 | Ga0466707_286272 | 3300042601 | Bacteria | 22213 |
| 44 | Ga0466705_285670 | 3300042612 | Bacteria | 11403 |
| 45 | Ga0466692_001103 | 3300042591 | Bacteria | 29670 |
| 46 | Ga0466692_023608 | 3300042591 | Bacteria | 56587 |
| 47 | Ga0466701_002767 | 3300042598 | Bacteria | 1804 |
| 48 | Ga0123356_10560644 | 3300010049 | Bacteria | 1304 |
| 49 | Ga0123353_10691126 | 3300010167 | Bacteria | 1434 |
| 50 | 2227611022 | 2225789004 | Bacteria | 2261 |
| 51 | IMNBL1DRAFT_c0000378 | 3300000062 | Bacteria | 38118 |
| 52 | Ga0466735_110580 | 3300042624 | Bacteria | 1366 |
| 53 | Ga0466704_033639 | 3300042643 | Bacteria | 2388 |
| 54 | Ga0466727_041042 | 3300042655 | Bacteria | 9323 |
| 55 | Ga0466706_028935 | 3300042599 | Bacteria | 40791 |
| 56 | Ga0466707_043579 | 3300042601 | Bacteria | 21754 |
| 57 | Ga0466713_094343 | 3300042602 | Bacteria | 28200 |
| 58 | Ga0466719_291253 | 3300042606 | Unclassified | 1983 |
| 59 | Ga0466697_020630 | 3300042611 | Bacteria | 2653 |
| 60 | Ga0466728_446108 | 3300042620 | Bacteria | 9754 |
| 61 | Ga0123356_10008114 | 3300010049 | Bacteria | 10459 |
| 62 | Ga0123356_10331187 | 3300010049 | Bacteria | 1639 |
| 63 | Ga0123353_11625858 | 3300010167 | Unclassified | 814 |
| 64 | Ga0466734_063961 | 3300042623 | Bacteria | 1283 |
| 65 | Ga0466735_055931 | 3300042624 | Bacteria | 6840 |
| 66 | Ga0466735_105390 | 3300042624 | Unclassified | 1177 |
| 67 | Ga0466703_331730 | 3300042636 | Bacteria | 2034 |
| 68 | Ga0466709_115025 | 3300042648 | Bacteria | 26433 |
| 69 | Ga0466706_174920 | 3300042599 | Bacteria | 12699 |
| 70 | Ga0466700_156051 | 3300042600 | Bacteria | 11233 |
| 71 | Ga0466719_545997 | 3300042606 | Bacteria | 4165 |
| 72 | Ga0466729_185141 | 3300042621 | Bacteria | 6724 |
| 73 | Ga0466703_017024 | 3300042636 | Bacteria | 4840 |
| 74 | Ga0466703_022363 | 3300042636 | Bacteria | 6961 |
| 75 | Ga0466707_228190 | 3300042601 | Bacteria | 1433 |
| 76 | Ga0466713_048749 | 3300042602 | Bacteria | 15078 |
| 77 | Ga0466705_171942 | 3300042612 | Bacteria | 3540 |
| 78 | Ga0466733_151782 | 3300042659 | Bacteria | 38867 |
| 79 | Ga0466711_414115 | 3300042615 | Bacteria | 1330 |
| 80 | Ga0466726_147809 | 3300042619 | Bacteria | 13302 |
| 81 | Ga0466690_039406 | 3300042590 | Bacteria | 20122 |
| 82 | Ga0123353_10821870 | 3300010167 | Bacteria | 1279 |
| 83 | JGI24705J35276_12211676 | 3300002504 | Unclassified | 1863 |
| 84 | JGI24699J35502_11133933 | 3300002509 | Bacteria | 19996 |
| 85 | Ga0466735_033307 | 3300042624 | Bacteria | 1578 |
| 86 | Ga0466735_198133 | 3300042624 | Bacteria | 1490 |
| 87 | Ga0466703_104304 | 3300042636 | Unclassified | 2617 |
| 88 | Ga0466704_339221 | 3300042643 | Bacteria | 6084 |
| 89 | Ga0466727_254373 | 3300042655 | Bacteria | 6810 |
| 90 | Ga0466701_102589 | 3300042598 | Bacteria | 16726 |
| 91 | Ga0466700_171123 | 3300042600 | Bacteria | 10801 |
| 92 | Ga0466707_404532 | 3300042601 | Bacteria | 3556 |
| 93 | Ga0466713_000548 | 3300042602 | Bacteria | 3463 |
| 94 | Ga0466719_219545 | 3300042606 | Bacteria | 7205 |
| 95 | Ga0466711_506918 | 3300042615 | Bacteria | 9365 |
| 96 | Ga0466715_070660 | 3300042616 | Bacteria | 9155 |
| 97 | Ga0466691_195596 | 3300042593 | Bacteria | 68522 |
| 98 | Ga0466694_215952 | 3300042594 | Bacteria | 3015 |
| 99 | Ga0123357_10197865 | 3300009784 | Bacteria | 2296 |
| 100 | Ga0123353_10490316 | 3300010167 | Bacteria | 1794 |
| 101 | IMNBL1DRAFT_c0019853 | 3300000062 | Unclassified | 2739 |
| 102 | Ga0466731_329290 | 3300042622 | Unclassified | 1170 |
| 103 | Ga0466704_543094 | 3300042643 | Bacteria | 8025 |
| 104 | Ga0466727_167127 | 3300042655 | Bacteria | 3449 |
| 105 | Ga0466727_173858 | 3300042655 | Bacteria | 64235 |
| 106 | Ga0466719_221878 | 3300042606 | Bacteria | 1757 |
| 107 | Ga0466722_132870 | 3300042609 | Bacteria | 22775 |
| 108 | Ga0466722_197440 | 3300042609 | Bacteria | 36283 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04055 | Radical_SAM | Radical SAM superfamily | 29 | 119 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.