Protein Family IF06091
Metagenome
Isolate
193
Members
119
Samples
133
Scaffolds
288.77
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_073699|Ga0466713_073699_15_968
- Length
- 317 aa
- Sequence
- MNDNEVVVLSAAKDLTGQTKDPAATMPLTPRRKPKKPAKTIGQILLYLALALFSAFLLLPFFWMISSSLKPDNEVFTIPIKWIPETFRWSNYVDIWTVQVTQQASNMSIWLKNTLILAVTVTALQLFTGSFAAYGFARIRFPGRDLLFLAYIATIAVPWQAYMIPQYKMFSMLGLTDTLWSIIILQAFGAFGVFLMKQFYETIPEELSESARLDGLSEYGIYRRIMLPLSVPALASLGLLTFVNTWNDFLGPRLYLRTPPHFTIQVGLKVFQADALGSSLYGLMFAGAVISVLPIAIIFMAGQRYFVEGIATSGMKG
Sample Types
Isolate
31.1%
Metagenome
68.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.1%
Termitidae
19.8%
Apidae
14.4%
Kalotermitidae
10.8%
Culicidae
5.4%
Scarabaeidae
4.5%
Tenebrionidae
3.6%
Rhinotermitidae
2.7%
Armadillidiidae
2.7%
Blattidae
2.7%
Formicidae
1.8%
Termopsidae
1.8%
Hydrophilidae
0.9%
Bombycidae
0.9%
Hodotermitidae
0.9%
Pyralidae
0.9%
Taxonomy
Archaea
1
Bacteria
186
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 2 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 3 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 4 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 5 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 6 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 11 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 16 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 17 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 18 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 25 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 29 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 30 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 31 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 32 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 33 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 35 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 36 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 39 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 45 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 46 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 47 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 48 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 49 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 50 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 51 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 54 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 55 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 56 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 57 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 58 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 59 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 60 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 61 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 62 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 63 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 64 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 65 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 66 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 67 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 68 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 69 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 70 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 71 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 72 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 73 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 74 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 75 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 76 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 77 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 78 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 79 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 80 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 81 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 82 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 83 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 84 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 85 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 86 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 87 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 88 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 89 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 90 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 91 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 92 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 93 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 94 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 95 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 96 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 97 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 98 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 99 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 100 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 101 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 102 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 103 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 104 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 105 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 106 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 107 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 108 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 109 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 110 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 111 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 112 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 113 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 114 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 115 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 116 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 117 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 118 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 119 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0155 | 3300056790 | Bacteria | 206141 |
| 2 | Ga0562378_0207 | 3300056814 | Bacteria | 140012 |
| 3 | Ga0466706_117900 | 3300042599 | Bacteria | 2155 |
| 4 | Ga0466713_142150 | 3300042602 | Bacteria | 1902 |
| 5 | Ga0466713_147943 | 3300042602 | Bacteria | 10360 |
| 6 | Ga0466722_188390 | 3300042609 | Bacteria | 13075 |
| 7 | Ga0123357_10046014 | 3300009784 | Bacteria | 5918 |
| 8 | Ga0123355_10054342 | 3300009826 | Bacteria | 6489 |
| 9 | Ga0123356_10059243 | 3300010049 | Bacteria | 3572 |
| 10 | Ga0123353_10171865 | 3300010167 | Bacteria | 3439 |
| 11 | Ga0123353_10220920 | 3300010167 | Bacteria | 2962 |
| 12 | Ga0160454_100788 | 3300012798 | Bacteria | 6284 |
| 13 | Ga0160447_104871 | 3300012849 | Unclassified | 3865 |
| 14 | Ga0466696_481081 | 3300042596 | Bacteria | 6524 |
| 15 | Ga0466731_374711 | 3300042622 | Bacteria | 3899 |
| 16 | Ga0466704_314706 | 3300042643 | Bacteria | 2857 |
| 17 | Ga0466724_02376 | 3300042649 | Bacteria | 14153 |
| 18 | JGI24699J35502_11123047 | 3300002509 | Bacteria | 3499 |
| 19 | Ga0068305_10118276 | 3300005083 | Bacteria | 19654 |
| 20 | Ga0074278_143184 | 3300005721 | Bacteria | 1453 |
| 21 | Ga0466733_042229 | 3300042659 | Bacteria | 24292 |
| 22 | Ga0562378_0103 | 3300056814 | Bacteria | 223931 |
| 23 | Ga0466723_154196 | 3300042618 | Bacteria | 18223 |
| 24 | Ga0466706_219053 | 3300042599 | Bacteria | 1515 |
| 25 | Ga0466713_035511 | 3300042602 | Bacteria | 4423 |
| 26 | Ga0123355_10005986 | 3300009826 | Bacteria | 17935 |
| 27 | Ga0123353_10338956 | 3300010167 | Bacteria | 2272 |
| 28 | Ga0160452_100265 | 3300012834 | Bacteria | 50112 |
| 29 | Ga0160445_102316 | 3300012847 | Bacteria | 4472 |
| 30 | Ga0160443_100221 | 3300012848 | Bacteria | 69197 |
| 31 | Ga0466691_024900 | 3300042593 | Bacteria | 9069 |
| 32 | Ga0466703_411922 | 3300042636 | Bacteria | 3694 |
| 33 | JGI24703J35330_11747988 | 3300002501 | Bacteria | 9677 |
| 34 | JGI24705J35276_12193992 | 3300002504 | Unclassified | 1506 |
| 35 | CVPL010L_1001027 | 3300002932 | Unclassified | 6722 |
| 36 | Ga0072940_1049611 | 3300005200 | Bacteria | 7187 |
| 37 | Ga0072940_1399281 | 3300005200 | Bacteria | 1097 |
| 38 | Ga0466705_244887 | 3300042612 | Bacteria | 4182 |
| 39 | Ga0562375_0062 | 3300056856 | Bacteria | 424406 |
| 40 | Ga0466728_308270 | 3300042620 | Bacteria | 16503 |
| 41 | Ga0466714_144747 | 3300042603 | Bacteria | 6543 |
| 42 | Ga0123357_10126614 | 3300009784 | Bacteria | 3197 |
| 43 | Ga0123353_10018993 | 3300010167 | Bacteria | 10198 |
| 44 | Ga0123354_10055617 | 3300010882 | Bacteria | 5918 |
| 45 | Ga0466690_260168 | 3300042590 | Bacteria | 1132 |
| 46 | Ga0466730_000393 | 3300042625 | Bacteria | 1156 |
| 47 | Ga0466703_426558 | 3300042636 | Bacteria | 3302 |
| 48 | Ga0072941_1168593 | 3300005201 | Bacteria | 10206 |
| 49 | Ga0466733_117310 | 3300042659 | Bacteria | 18714 |
| 50 | Ga0466729_169695 | 3300042621 | Bacteria | 14289 |
| 51 | Ga0466706_103556 | 3300042599 | Bacteria | 2124 |
| 52 | Ga0466706_239508 | 3300042599 | Bacteria | 58799 |
| 53 | Ga0466707_072993 | 3300042601 | Bacteria | 64242 |
| 54 | Ga0466716_328546 | 3300042605 | Bacteria | 2345 |
| 55 | Ga0466719_555520 | 3300042606 | Bacteria | 3333 |
| 56 | Ga0466722_054280 | 3300042609 | Bacteria | 2349 |
| 57 | Ga0123357_10083835 | 3300009784 | Bacteria | 4181 |
| 58 | Ga0123355_10000409 | 3300009826 | Bacteria | 55870 |
| 59 | Ga0123356_10000010 | 3300010049 | Bacteria | 220063 |
| 60 | Ga0123356_10030922 | 3300010049 | Bacteria | 5010 |
| 61 | Ga0123356_10033639 | 3300010049 | Bacteria | 4794 |
| 62 | Ga0123353_10656424 | 3300010167 | Bacteria | 1484 |
| 63 | Ga0160445_103689 | 3300012847 | Bacteria | 2998 |
| 64 | Ga0160436_1000059 | 3300012861 | Bacteria | 59959 |
| 65 | JGI24695J34938_10020765 | 3300002450 | Bacteria | 3226 |
| 66 | JGI24699J35502_11051298 | 3300002509 | Bacteria | 1654 |
| 67 | Ga0466733_118672 | 3300042659 | Bacteria | 22532 |
| 68 | Ga0466726_398604 | 3300042619 | Bacteria | 1771 |
| 69 | Ga0466729_173722 | 3300042621 | Bacteria | 1278 |
| 70 | Ga0466706_209135 | 3300042599 | Bacteria | 7136 |
| 71 | Ga0466717_239473 | 3300042604 | Bacteria | 6914 |
| 72 | Ga0466719_554266 | 3300042606 | Bacteria | 26183 |
| 73 | Ga0123357_10003720 | 3300009784 | Bacteria | 17618 |
| 74 | Ga0123357_10018055 | 3300009784 | Bacteria | 9368 |
| 75 | Ga0123356_10746945 | 3300010049 | Bacteria | 1148 |
| 76 | Ga0123353_10991858 | 3300010167 | Bacteria | 1130 |
| 77 | Ga0160430_101789 | 3300012852 | Bacteria | 7525 |
| 78 | Ga0466696_367274 | 3300042596 | Bacteria | 3862 |
| 79 | Ga0466725_464216 | 3300042654 | Bacteria | 3924 |
| 80 | JGI24703J35330_11747998 | 3300002501 | Archaea | 9756 |
| 81 | JGI24705J35276_12225614 | 3300002504 | Unclassified | 2744 |
| 82 | Ga0466705_322911 | 3300042612 | Unclassified | 3044 |
| 83 | Ga0466705_451134 | 3300042612 | Bacteria | 6942 |
| 84 | Ga0466711_201079 | 3300042615 | Bacteria | 18389 |
| 85 | Ga0466726_211605 | 3300042619 | Bacteria | 1554 |
| 86 | Ga0466728_104307 | 3300042620 | Bacteria | 1649 |
| 87 | Ga0466713_039454 | 3300042602 | Bacteria | 10704 |
| 88 | Ga0466714_006450 | 3300042603 | Bacteria | 4444 |
| 89 | Ga0466719_243853 | 3300042606 | Bacteria | 6014 |
| 90 | Ga0123353_10041323 | 3300010167 | Bacteria | 7282 |
| 91 | Ga0160467_100073 | 3300012829 | Bacteria | 152393 |
| 92 | Ga0466692_186235 | 3300042591 | Bacteria | 5178 |
| 93 | Ga0466704_069847 | 3300042643 | Bacteria | 3659 |
| 94 | Ga0466709_272603 | 3300042648 | Bacteria | 7574 |
| 95 | Ga0466725_348724 | 3300042654 | Bacteria | 1583 |
| 96 | JGI24696J40584_12958168 | 3300002834 | Bacteria | 3936 |
| 97 | Ga0123357_10000020 | 3300009784 | Bacteria | 141555 |
| 98 | Ga0562375_0054 | 3300056856 | Bacteria | 456645 |
| 99 | Ga0466723_077145 | 3300042618 | Bacteria | 54484 |
| 100 | Ga0466726_296929 | 3300042619 | Bacteria | 2283 |
| 101 | Ga0466726_311250 | 3300042619 | Bacteria | 2527 |
| 102 | Ga0466700_396302 | 3300042600 | Bacteria | 7445 |
| 103 | Ga0466719_228736 | 3300042606 | Bacteria | 92829 |
| 104 | Ga0123357_10029577 | 3300009784 | Bacteria | 7423 |
| 105 | Ga0123355_10529010 | 3300009826 | Bacteria | 1438 |
| 106 | Ga0123353_10000060 | 3300010167 | Bacteria | 123051 |
| 107 | Ga0123354_10000253 | 3300010882 | Bacteria | 47997 |
| 108 | Ga0160442_100518 | 3300012806 | Bacteria | 8926 |
| 109 | Ga0160446_100148 | 3300012835 | Bacteria | 56660 |
| 110 | Ga0160460_101041 | 3300012845 | Bacteria | 11242 |
| 111 | Ga0160434_100007 | 3300012850 | Bacteria | 314941 |
| 112 | Ga0466704_412729 | 3300042643 | Bacteria | 61439 |
| 113 | Ga0466725_467554 | 3300042654 | Bacteria | 18328 |
| 114 | Ga0466727_245978 | 3300042655 | Bacteria | 7486 |
| 115 | JGI24698J34947_10009067 | 3300002449 | Bacteria | 5458 |
| 116 | Ga0466733_048903 | 3300042659 | Bacteria | 2811 |
| 117 | Ga0466718_132739 | 3300042617 | Bacteria | 13210 |
| 118 | Ga0466723_108354 | 3300042618 | Bacteria | 2396 |
| 119 | Ga0466706_147359 | 3300042599 | Bacteria | 36054 |
| 120 | Ga0466713_061160 | 3300042602 | Bacteria | 3238 |
| 121 | Ga0466713_073699 | 3300042602 | Bacteria | 1319 |
| 122 | Ga0123357_10005156 | 3300009784 | Unclassified | 15587 |
| 123 | Ga0123355_10011109 | 3300009826 | Bacteria | 13866 |
| 124 | Ga0123353_10378596 | 3300010167 | Bacteria | 2118 |
| 125 | Ga0160441_100191 | 3300012825 | Bacteria | 63368 |
| 126 | Ga0160430_100018 | 3300012852 | Bacteria | 229539 |
| 127 | Ga0160435_1000593 | 3300012857 | Bacteria | 10855 |
| 128 | Ga0415639_228980 | 3300038395 | Bacteria | 1271 |
| 129 | Ga0466703_067898 | 3300042636 | Bacteria | 8268 |
| 130 | Ga0466703_103691 | 3300042636 | Bacteria | 71973 |
| 131 | Ga0466704_034783 | 3300042643 | Bacteria | 163660 |
| 132 | Ga0466704_078263 | 3300042643 | Bacteria | 5911 |
| 133 | Ga0466727_278783 | 3300042655 | Bacteria | 2473 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 126 | 309 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.