Protein Family IF06051
Metagenome
Isolate
181
Members
43
Samples
178
Scaffolds
277.94
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_032001|Ga0466713_032001_4325_5242
- Length
- 305 aa
- Sequence
- MKLYKVKKVVTTILVYIELTAVAVAILYPLAWVLGSSLNPQAGISRSGILPTRDVPVTGPDGAAVLNADGSPKTESRIAVTLNNYKKLFTKTSYGRWYLNTLFVAVITTLFSIIIHTMTAFVFARFRFKGQKMGLLLVMILQMFPSFMGLTALYMVALNFNMLNNLFMLVIIYVAGGIPGNIWLVRGYMLNIPRSMDEAASIDGVTKLQLFYKIILPLSMPIIFFIAVTSFMGPWMDYMLPRYLINEDAKRTLAIGLFDLINGTNADFAAFCAGAVLVAVPITALYMGFQRFLLEGLMAGANKGE
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
33.3%
Unclassified
14.3%
Rhinotermitidae
9.5%
Termopsidae
7.1%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_093317 | 3300042612 | Bacteria | 4642 |
| 2 | Ga0466711_023917 | 3300042615 | Bacteria | 1586 |
| 3 | Ga0466718_050975 | 3300042617 | Bacteria | 1270 |
| 4 | Ga0466726_067461 | 3300042619 | Bacteria | 12588 |
| 5 | Ga0466728_113921 | 3300042620 | Unclassified | 2559 |
| 6 | Ga0456237_0001480 | 3300041968 | Bacteria | 3738 |
| 7 | Ga0466690_146906 | 3300042590 | Bacteria | 5889 |
| 8 | Ga0466696_275131 | 3300042596 | Bacteria | 20301 |
| 9 | Ga0466713_032001 | 3300042602 | Bacteria | 6512 |
| 10 | Ga0466713_035980 | 3300042602 | Bacteria | 7186 |
| 11 | Ga0466720_061712 | 3300042607 | Unclassified | 5578 |
| 12 | Ga0466735_125874 | 3300042624 | Bacteria | 5184 |
| 13 | Ga0466703_276541 | 3300042636 | Bacteria | 11629 |
| 14 | Ga0466727_008554 | 3300042655 | Bacteria | 4925 |
| 15 | Ga0123356_10026292 | 3300010049 | Bacteria | 5467 |
| 16 | JGI24695J34938_10107431 | 3300002450 | Bacteria | 1138 |
| 17 | Ga0466712_322121 | 3300042614 | Bacteria | 23117 |
| 18 | Ga0466715_086092 | 3300042616 | Unclassified | 1248 |
| 19 | Ga0466715_587493 | 3300042616 | Bacteria | 8970 |
| 20 | Ga0466723_006612 | 3300042618 | Bacteria | 5796 |
| 21 | Ga0466728_048538 | 3300042620 | Bacteria | 1998 |
| 22 | Ga0466728_176720 | 3300042620 | Bacteria | 10261 |
| 23 | Ga0456237_0000953 | 3300041968 | Bacteria | 4553 |
| 24 | Ga0466690_057541 | 3300042590 | Bacteria | 6288 |
| 25 | Ga0466692_033285 | 3300042591 | Bacteria | 3775 |
| 26 | Ga0466692_156302 | 3300042591 | Bacteria | 12386 |
| 27 | Ga0466691_067641 | 3300042593 | Bacteria | 11763 |
| 28 | Ga0466694_158510 | 3300042594 | Bacteria | 16066 |
| 29 | Ga0466696_281842 | 3300042596 | Bacteria | 10792 |
| 30 | Ga0466719_376898 | 3300042606 | Bacteria | 5377 |
| 31 | Ga0466721_299308 | 3300042608 | Bacteria | 13542 |
| 32 | Ga0466722_038890 | 3300042609 | Bacteria | 6473 |
| 33 | Ga0466735_105140 | 3300042624 | Bacteria | 4108 |
| 34 | Ga0466703_416037 | 3300042636 | Bacteria | 22355 |
| 35 | Ga0466704_043077 | 3300042643 | Bacteria | 26616 |
| 36 | Ga0466704_258655 | 3300042643 | Bacteria | 4470 |
| 37 | Ga0466709_280205 | 3300042648 | Unclassified | 3960 |
| 38 | Ga0466708_466672 | 3300042652 | Bacteria | 38602 |
| 39 | JGI24698J34947_10003168 | 3300002449 | Bacteria | 8906 |
| 40 | JGI24698J34947_10047219 | 3300002449 | Unclassified | 2187 |
| 41 | Ga0466711_017715 | 3300042615 | Bacteria | 23309 |
| 42 | Ga0466715_638685 | 3300042616 | Bacteria | 11241 |
| 43 | Ga0466723_201635 | 3300042618 | Bacteria | 12489 |
| 44 | Ga0466726_080786 | 3300042619 | Bacteria | 2145 |
| 45 | Ga0466726_364916 | 3300042619 | Bacteria | 1463 |
| 46 | Ga0466729_138364 | 3300042621 | Bacteria | 3026 |
| 47 | Ga0466690_007674 | 3300042590 | Bacteria | 1805 |
| 48 | Ga0466696_037360 | 3300042596 | Bacteria | 6285 |
| 49 | Ga0466720_166641 | 3300042607 | Bacteria | 1198 |
| 50 | Ga0466703_287690 | 3300042636 | Bacteria | 24697 |
| 51 | Ga0466704_070602 | 3300042643 | Bacteria | 13396 |
| 52 | Ga0466704_193514 | 3300042643 | Bacteria | 13551 |
| 53 | Ga0466704_479197 | 3300042643 | Bacteria | 7548 |
| 54 | Ga0466709_089825 | 3300042648 | Bacteria | 5513 |
| 55 | Ga0466708_125164 | 3300042652 | Unclassified | 1842 |
| 56 | Ga0466727_287771 | 3300042655 | Bacteria | 7502 |
| 57 | Ga0123353_10000410 | 3300010167 | Bacteria | 52963 |
| 58 | Ga0123353_10015229 | 3300010167 | Bacteria | 11153 |
| 59 | AustNasuHG_c1017782 | 3300000089 | Bacteria | 2358 |
| 60 | Ga0072940_1003088 | 3300005200 | Bacteria | 13421 |
| 61 | Ga0072941_1083143 | 3300005201 | Bacteria | 1583 |
| 62 | Ga0466705_435229 | 3300042612 | Bacteria | 3727 |
| 63 | Ga0466723_040026 | 3300042618 | Bacteria | 51776 |
| 64 | Ga0466723_317835 | 3300042618 | Unclassified | 2159 |
| 65 | Ga0466728_274305 | 3300042620 | Bacteria | 1866 |
| 66 | Ga0466729_039123 | 3300042621 | Bacteria | 10482 |
| 67 | Ga0466690_090923 | 3300042590 | Bacteria | 1835 |
| 68 | Ga0466696_202452 | 3300042596 | Bacteria | 9449 |
| 69 | Ga0466716_311153 | 3300042605 | Bacteria | 20308 |
| 70 | Ga0466719_193385 | 3300042606 | Bacteria | 2526 |
| 71 | Ga0466719_440970 | 3300042606 | Bacteria | 7936 |
| 72 | Ga0466722_089967 | 3300042609 | Bacteria | 7742 |
| 73 | Ga0466703_016398 | 3300042636 | Unclassified | 5176 |
| 74 | Ga0466704_329495 | 3300042643 | Bacteria | 24792 |
| 75 | Ga0466704_339474 | 3300042643 | Bacteria | 18180 |
| 76 | Ga0466708_069765 | 3300042652 | Bacteria | 4614 |
| 77 | Ga0466708_079899 | 3300042652 | Bacteria | 17009 |
| 78 | AustNasuHG_c1002765 | 3300000089 | Bacteria | 6327 |
| 79 | JGI24695J34938_10003037 | 3300002450 | Bacteria | 12040 |
| 80 | JGI24695J34938_10014881 | 3300002450 | Bacteria | 4011 |
| 81 | JGI24695J34938_10015185 | 3300002450 | Bacteria | 3959 |
| 82 | Ga0466705_057380 | 3300042612 | Bacteria | 9491 |
| 83 | Ga0466705_102688 | 3300042612 | Bacteria | 17173 |
| 84 | Ga0466732_200482 | 3300042656 | Bacteria | 8834 |
| 85 | Ga0466711_493305 | 3300042615 | Bacteria | 2218 |
| 86 | Ga0466715_113293 | 3300042616 | Bacteria | 6538 |
| 87 | Ga0466718_143775 | 3300042617 | Bacteria | 6491 |
| 88 | Ga0466726_010051 | 3300042619 | Bacteria | 2398 |
| 89 | Ga0466728_083198 | 3300042620 | Bacteria | 1663 |
| 90 | Ga0466728_104662 | 3300042620 | Bacteria | 7863 |
| 91 | Ga0466690_216963 | 3300042590 | Unclassified | 3044 |
| 92 | Ga0466693_243848 | 3300042592 | Bacteria | 7600 |
| 93 | Ga0466691_035561 | 3300042593 | Bacteria | 7589 |
| 94 | Ga0466707_015393 | 3300042601 | Bacteria | 10517 |
| 95 | Ga0466719_327657 | 3300042606 | Bacteria | 1451 |
| 96 | Ga0466720_031221 | 3300042607 | Bacteria | 10342 |
| 97 | Ga0466720_031819 | 3300042607 | Bacteria | 4476 |
| 98 | Ga0466720_167237 | 3300042607 | Bacteria | 43895 |
| 99 | Ga0466722_258224 | 3300042609 | Bacteria | 6205 |
| 100 | Ga0466703_309850 | 3300042636 | Bacteria | 12702 |
| 101 | Ga0466703_350882 | 3300042636 | Bacteria | 30976 |
| 102 | Ga0466709_037407 | 3300042648 | Bacteria | 3655 |
| 103 | Ga0123353_10182389 | 3300010167 | Bacteria | 3322 |
| 104 | JGI24698J34947_10047227 | 3300002449 | Unclassified | 2187 |
| 105 | Ga0466711_000481 | 3300042615 | Bacteria | 5104 |
| 106 | Ga0466711_085727 | 3300042615 | Bacteria | 11389 |
| 107 | Ga0466711_490104 | 3300042615 | Bacteria | 12804 |
| 108 | Ga0466715_039871 | 3300042616 | Bacteria | 33977 |
| 109 | Ga0466715_536337 | 3300042616 | Bacteria | 4477 |
| 110 | Ga0466723_069351 | 3300042618 | Bacteria | 9903 |
| 111 | Ga0466726_276570 | 3300042619 | Bacteria | 6561 |
| 112 | Ga0466692_114503 | 3300042591 | Bacteria | 1291 |
| 113 | Ga0466706_193010 | 3300042599 | Bacteria | 1092 |
| 114 | Ga0466716_234703 | 3300042605 | Bacteria | 3732 |
| 115 | Ga0466716_518753 | 3300042605 | Unclassified | 1267 |
| 116 | Ga0466703_054134 | 3300042636 | Bacteria | 22697 |
| 117 | Ga0466704_086262 | 3300042643 | Bacteria | 7740 |
| 118 | Ga0466704_312188 | 3300042643 | Bacteria | 13650 |
| 119 | Ga0466708_019053 | 3300042652 | Bacteria | 4817 |
| 120 | Ga0466708_110857 | 3300042652 | Bacteria | 17356 |
| 121 | Ga0466708_196841 | 3300042652 | Unclassified | 2022 |
| 122 | Ga0466708_198827 | 3300042652 | Bacteria | 20273 |
| 123 | Ga0466727_099926 | 3300042655 | Bacteria | 2189 |
| 124 | 2230969662 | 2228664004 | Bacteria | 5609 |
| 125 | AustNasuHG_c1006771 | 3300000089 | Bacteria | 4085 |
| 126 | JGI24698J34947_10000422 | 3300002449 | Bacteria | 19377 |
| 127 | JGI24698J34947_10014007 | 3300002449 | Bacteria | 4370 |
| 128 | JGI24695J34938_10001729 | 3300002450 | Bacteria | 18040 |
| 129 | Ga0466705_047507 | 3300042612 | Bacteria | 13366 |
| 130 | Ga0466705_397116 | 3300042612 | Bacteria | 8102 |
| 131 | Ga0466712_080762 | 3300042614 | Bacteria | 3760 |
| 132 | Ga0466715_101235 | 3300042616 | Bacteria | 25907 |
| 133 | Ga0466715_523254 | 3300042616 | Unclassified | 1219 |
| 134 | Ga0466718_052692 | 3300042617 | Bacteria | 21462 |
| 135 | Ga0466723_283832 | 3300042618 | Bacteria | 5788 |
| 136 | Ga0466726_346476 | 3300042619 | Bacteria | 11443 |
| 137 | Ga0466728_141123 | 3300042620 | Bacteria | 6142 |
| 138 | Ga0466728_253721 | 3300042620 | Bacteria | 12222 |
| 139 | Ga0466690_335729 | 3300042590 | Unclassified | 2782 |
| 140 | Ga0466692_103112 | 3300042591 | Unclassified | 24122 |
| 141 | Ga0466692_172808 | 3300042591 | Bacteria | 2010 |
| 142 | Ga0466696_411937 | 3300042596 | Bacteria | 2177 |
| 143 | Ga0466719_033421 | 3300042606 | Bacteria | 14037 |
| 144 | Ga0466720_013045 | 3300042607 | Bacteria | 4163 |
| 145 | Ga0466720_194055 | 3300042607 | Bacteria | 10585 |
| 146 | Ga0466722_108133 | 3300042609 | Bacteria | 4325 |
| 147 | Ga0466704_039632 | 3300042643 | Bacteria | 4252 |
| 148 | Ga0466709_146817 | 3300042648 | Bacteria | 30075 |
| 149 | Ga0466709_369852 | 3300042648 | Bacteria | 14932 |
| 150 | Ga0466708_008170 | 3300042652 | Bacteria | 20295 |
| 151 | Ga0466708_084544 | 3300042652 | Bacteria | 2663 |
| 152 | Ga0123356_10051796 | 3300010049 | Bacteria | 3819 |
| 153 | Ga0123356_10090769 | 3300010049 | Bacteria | 2910 |
| 154 | Ga0123356_10571759 | 3300010049 | Bacteria | 1293 |
| 155 | Ga0123356_10590854 | 3300010049 | Bacteria | 1274 |
| 156 | JGI24698J34947_10002901 | 3300002449 | Bacteria | 9298 |
| 157 | Ga0068305_10646086 | 3300005083 | Bacteria | 4301 |
| 158 | Ga0466705_325592 | 3300042612 | Bacteria | 9963 |
| 159 | Ga0466727_351488 | 3300042655 | Bacteria | 1292 |
| 160 | Ga0466732_017595 | 3300042656 | Bacteria | 13103 |
| 161 | Ga0466712_226020 | 3300042614 | Bacteria | 5028 |
| 162 | Ga0466711_161629 | 3300042615 | Bacteria | 10758 |
| 163 | Ga0466723_003692 | 3300042618 | Bacteria | 39405 |
| 164 | Ga0466723_024294 | 3300042618 | Bacteria | 10279 |
| 165 | Ga0466726_146627 | 3300042619 | Bacteria | 2028 |
| 166 | Ga0466726_230187 | 3300042619 | Unclassified | 1259 |
| 167 | Ga0466691_024140 | 3300042593 | Bacteria | 10326 |
| 168 | Ga0466691_224664 | 3300042593 | Bacteria | 4376 |
| 169 | Ga0466694_237806 | 3300042594 | Unclassified | 1035 |
| 170 | Ga0466716_410717 | 3300042605 | Unclassified | 12896 |
| 171 | Ga0466719_462613 | 3300042606 | Bacteria | 6042 |
| 172 | Ga0466703_050588 | 3300042636 | Bacteria | 19740 |
| 173 | Ga0466703_177637 | 3300042636 | Bacteria | 197398 |
| 174 | Ga0466704_180043 | 3300042643 | Unclassified | 3722 |
| 175 | Ga0466709_042876 | 3300042648 | Bacteria | 2455 |
| 176 | JGI24698J34947_10006450 | 3300002449 | Bacteria | 6437 |
| 177 | JGI24695J34938_10021091 | 3300002450 | Unclassified | 3193 |
| 178 | Ga0068305_10064229 | 3300005083 | Unclassified | 2377 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 119 | 293 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.