Protein Family IF06046
Metagenome
Isolate
135
Members
51
Samples
128
Scaffolds
289.09
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_029206|Ga0466713_029206_3172_4263
- Length
- 333 aa
- Sequence
- MAALKEIKKRINSITGTRKTTSAMKMVSSAKLHKAESLIANMLPYSDAMRRVMAAALQDAANRVPTEGSLIVPSLREHSATPSLRGTKQSPDGLLHSVRNDEREPVKPALVVFSSDASLCGAFNSNVFRETLSIINEYKGADIKLYTIGKKITDACRKTGVKVAQSFETLASKPDYGVIAQLGADLLAQFNRGEISRVELVYHHFRSAGSQELKRTTLLPVDLKQEPITIHGTSMQGEKRETTPSGMRTVDYIFEPTYEELLNTLIPITIKLQLYTALLDSNVSEHAARMVAMQTATDNADDLICELTIEYNKSRQQAITNELLDIVSGGIKN
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.0%
Kalotermitidae
24.0%
Unclassified
12.0%
Termopsidae
8.0%
Blattidae
8.0%
Rhinotermitidae
6.0%
Passalidae
4.0%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 27 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 36 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_198086 | 3300042611 | Bacteria | 1838 |
| 2 | 2227630172 | 2225789004 | Bacteria | 11449 |
| 3 | IMNBL1DRAFT_c0042747 | 3300000062 | Bacteria | 1507 |
| 4 | Ga0466729_235491 | 3300042621 | Bacteria | 1239 |
| 5 | Ga0466735_043706 | 3300042624 | Bacteria | 1037 |
| 6 | Ga0466735_072164 | 3300042624 | Bacteria | 9859 |
| 7 | Ga0466727_159863 | 3300042655 | Bacteria | 2402 |
| 8 | Ga0466700_115552 | 3300042600 | Bacteria | 26876 |
| 9 | Ga0466713_037944 | 3300042602 | Bacteria | 60611 |
| 10 | Ga0466690_196376 | 3300042590 | Bacteria | 23671 |
| 11 | Ga0123353_10208754 | 3300010167 | Bacteria | 3065 |
| 12 | Ga0123353_10812991 | 3300010167 | Bacteria | 1288 |
| 13 | Ga0466733_119841 | 3300042659 | Bacteria | 10893 |
| 14 | IMNBL1DRAFT_c0005484 | 3300000062 | Bacteria | 7234 |
| 15 | JGI24696J40584_12960071 | 3300002834 | Bacteria | 6255 |
| 16 | Ga0072941_1247181 | 3300005201 | Bacteria | 4573 |
| 17 | Ga0466701_050189 | 3300042598 | Bacteria | 5312 |
| 18 | Ga0466707_212426 | 3300042601 | Bacteria | 4546 |
| 19 | Ga0466713_044454 | 3300042602 | Bacteria | 40764 |
| 20 | Ga0466656_307241 | 3300042550 | Bacteria | 34645 |
| 21 | Ga0466690_160070 | 3300042590 | Bacteria | 10336 |
| 22 | Ga0466692_079572 | 3300042591 | Bacteria | 5576 |
| 23 | Ga0466696_422668 | 3300042596 | Bacteria | 2179 |
| 24 | Ga0466699_423066 | 3300042597 | Bacteria | 1431 |
| 25 | Ga0123357_10003885 | 3300009784 | Bacteria | 17329 |
| 26 | Ga0466715_229865 | 3300042616 | Bacteria | 7465 |
| 27 | Ga0466726_075903 | 3300042619 | Bacteria | 15757 |
| 28 | Ga0466705_014482 | 3300042612 | Bacteria | 8562 |
| 29 | IMNBL1DRAFT_c0017134 | 3300000062 | Bacteria | 3067 |
| 30 | JGI24705J35276_12236151 | 3300002504 | Bacteria | 7558 |
| 31 | Ga0068302_10059150 | 3300005071 | Bacteria | 9486 |
| 32 | Ga0466735_026681 | 3300042624 | Bacteria | 2322 |
| 33 | Ga0466703_190068 | 3300042636 | Bacteria | 14791 |
| 34 | Ga0466703_225275 | 3300042636 | Bacteria | 1582 |
| 35 | Ga0466703_370957 | 3300042636 | Bacteria | 3718 |
| 36 | Ga0466707_091732 | 3300042601 | Bacteria | 9253 |
| 37 | Ga0466722_108041 | 3300042609 | Bacteria | 10352 |
| 38 | Ga0466690_287214 | 3300042590 | Bacteria | 7991 |
| 39 | Ga0466691_026756 | 3300042593 | Bacteria | 7146 |
| 40 | Ga0466696_174826 | 3300042596 | Bacteria | 7607 |
| 41 | Ga0123353_10403710 | 3300010167 | Bacteria | 2032 |
| 42 | Ga0123353_10451930 | 3300010167 | Bacteria | 1891 |
| 43 | Ga0466710_177766 | 3300042613 | Bacteria | 1981 |
| 44 | Ga0466715_187147 | 3300042616 | Bacteria | 8455 |
| 45 | Ga0466729_184389 | 3300042621 | Bacteria | 9008 |
| 46 | Ga0466733_104810 | 3300042659 | Bacteria | 1752 |
| 47 | 2227497712 | 2225789004 | Bacteria | 3883 |
| 48 | JGI24702J35022_10000113 | 3300002462 | Bacteria | 38522 |
| 49 | JGI24702J35022_10026163 | 3300002462 | Bacteria | 3144 |
| 50 | Ga0068305_10337395 | 3300005083 | Bacteria | 2467 |
| 51 | Ga0466731_315168 | 3300042622 | Bacteria | 1299 |
| 52 | Ga0466735_141748 | 3300042624 | Bacteria | 4364 |
| 53 | Ga0466735_216890 | 3300042624 | Bacteria | 1257 |
| 54 | Ga0466703_408774 | 3300042636 | Bacteria | 21600 |
| 55 | Ga0466704_032743 | 3300042643 | Bacteria | 4746 |
| 56 | Ga0466727_113322 | 3300042655 | Bacteria | 53270 |
| 57 | Ga0466707_009147 | 3300042601 | Bacteria | 1325 |
| 58 | Ga0466707_064804 | 3300042601 | Bacteria | 33987 |
| 59 | Ga0466716_326483 | 3300042605 | Bacteria | 5146 |
| 60 | Ga0466697_010728 | 3300042611 | Bacteria | 11602 |
| 61 | Ga0466697_018309 | 3300042611 | Bacteria | 1388 |
| 62 | Ga0123357_10257839 | 3300009784 | Bacteria | 1850 |
| 63 | Ga0123356_10320861 | 3300010049 | Bacteria | 1662 |
| 64 | Ga0123354_10004306 | 3300010882 | Bacteria | 20122 |
| 65 | Ga0466711_505202 | 3300042615 | Bacteria | 7663 |
| 66 | Ga0466715_122515 | 3300042616 | Bacteria | 9863 |
| 67 | Ga0466715_408322 | 3300042616 | Bacteria | 3171 |
| 68 | Ga0466723_223421 | 3300042618 | Bacteria | 3946 |
| 69 | Ga0466728_252411 | 3300042620 | Bacteria | 19897 |
| 70 | 2227605166 | 2225789004 | Bacteria | 12371 |
| 71 | Ga0466704_056388 | 3300042643 | Bacteria | 4815 |
| 72 | Ga0466707_297387 | 3300042601 | Bacteria | 3240 |
| 73 | Ga0466693_121668 | 3300042592 | Bacteria | 1117 |
| 74 | Ga0466691_086050 | 3300042593 | Bacteria | 33199 |
| 75 | Ga0466696_122017 | 3300042596 | Bacteria | 2096 |
| 76 | Ga0123357_10125972 | 3300009784 | Bacteria | 3209 |
| 77 | Ga0123356_10069204 | 3300010049 | Bacteria | 3310 |
| 78 | Ga0123354_10072030 | 3300010882 | Bacteria | 4980 |
| 79 | Ga0466711_425360 | 3300042615 | Bacteria | 14894 |
| 80 | Ga0466728_138648 | 3300042620 | Bacteria | 1137 |
| 81 | Ga0068305_10686595 | 3300005083 | Bacteria | 2052 |
| 82 | Ga0466735_018807 | 3300042624 | Bacteria | 3170 |
| 83 | Ga0466735_192255 | 3300042624 | Bacteria | 1031 |
| 84 | Ga0466735_201378 | 3300042624 | Bacteria | 1269 |
| 85 | Ga0466735_202190 | 3300042624 | Unclassified | 1876 |
| 86 | Ga0466735_234247 | 3300042624 | Bacteria | 4211 |
| 87 | Ga0466701_101730 | 3300042598 | Bacteria | 1286 |
| 88 | Ga0466719_261157 | 3300042606 | Bacteria | 5504 |
| 89 | Ga0466722_078546 | 3300042609 | Bacteria | 3481 |
| 90 | Ga0466692_040903 | 3300042591 | Bacteria | 37710 |
| 91 | Ga0466696_220980 | 3300042596 | Bacteria | 1786 |
| 92 | Ga0123353_10456908 | 3300010167 | Bacteria | 1878 |
| 93 | Ga0466733_014441 | 3300042659 | Bacteria | 42619 |
| 94 | IMNBL1DRAFT_c0001635 | 3300000062 | Bacteria | 16581 |
| 95 | JGI24699J35502_11133457 | 3300002509 | Bacteria | 10767 |
| 96 | Ga0466735_087619 | 3300042624 | Bacteria | 2051 |
| 97 | Ga0466727_055861 | 3300042655 | Bacteria | 12488 |
| 98 | Ga0466713_029206 | 3300042602 | Bacteria | 9293 |
| 99 | Ga0466716_504537 | 3300042605 | Bacteria | 3692 |
| 100 | Ga0466722_016830 | 3300042609 | Bacteria | 4553 |
| 101 | Ga0466696_197935 | 3300042596 | Bacteria | 12852 |
| 102 | Ga0466711_207104 | 3300042615 | Bacteria | 23154 |
| 103 | Ga0466723_271716 | 3300042618 | Bacteria | 10061 |
| 104 | 2227275230 | 2225789004 | Bacteria | 30389 |
| 105 | IMNBL1DRAFT_c0006890 | 3300000062 | Unclassified | 6097 |
| 106 | Ga0072941_1218054 | 3300005201 | Bacteria | 2109 |
| 107 | Ga0466735_006537 | 3300042624 | Bacteria | 1826 |
| 108 | Ga0466735_142826 | 3300042624 | Bacteria | 4171 |
| 109 | Ga0466704_094118 | 3300042643 | Bacteria | 13096 |
| 110 | Ga0466725_040765 | 3300042654 | Bacteria | 4726 |
| 111 | Ga0466700_130152 | 3300042600 | Bacteria | 2960 |
| 112 | Ga0466707_062556 | 3300042601 | Bacteria | 45654 |
| 113 | Ga0466707_204931 | 3300042601 | Bacteria | 5029 |
| 114 | Ga0466713_020955 | 3300042602 | Bacteria | 68417 |
| 115 | Ga0466719_034182 | 3300042606 | Bacteria | 8828 |
| 116 | Ga0466719_231894 | 3300042606 | Bacteria | 3166 |
| 117 | Ga0466719_374563 | 3300042606 | Bacteria | 2367 |
| 118 | Ga0466692_008187 | 3300042591 | Bacteria | 121981 |
| 119 | Ga0466692_105261 | 3300042591 | Bacteria | 18499 |
| 120 | Ga0466692_107418 | 3300042591 | Bacteria | 14127 |
| 121 | Ga0466691_197646 | 3300042593 | Bacteria | 15559 |
| 122 | Ga0466715_074729 | 3300042616 | Bacteria | 20866 |
| 123 | Ga0466715_123526 | 3300042616 | Bacteria | 19351 |
| 124 | Ga0466715_429649 | 3300042616 | Bacteria | 20547 |
| 125 | Ga0466718_149073 | 3300042617 | Bacteria | 2517 |
| 126 | Ga0466726_178352 | 3300042619 | Bacteria | 9305 |
| 127 | Ga0466726_196835 | 3300042619 | Bacteria | 18400 |
| 128 | Ga0466729_175970 | 3300042621 | Bacteria | 6052 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00231 | ATP-synt | ATP synthase | 4 | 329 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.