Protein Family IF06023

Metagenome Metatranscriptome Isolate
152 Members
64 Samples
127 Scaffolds
375.2 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_011190|Ga0466713_011190_83284_84621
Length
445 aa
Sequence
MTRQRSSSVIIDLIHRLWTRLEIEFACEYNSLNINDQYYDFCVRRNTRKTSEQPAGMPEANEVLFWKGAGNMKKFLLALCGVCLMAGAGFAADTIKIGVVATMTGQNAFGGQLELEGMQLANKLHPEALGKKIELIIVDNKSDKVESANAASRLIEGDKVNALIGPYGSSATMAAGELAETAGIPLMGTACTNPLVTEGKKFVFRACFIDPFQGEAAANYAFNNLGYKKAAVLTDVASDYAVGLANFFKSNFTKLGGKIVADLKYQSGDTDFTSQLTAIIAQEPDVLFIPAYFAEGAIIMKQGYEQGAKFRFMGGDAMDNPDIVTLGGEAVEGFLHTTFAYDPSMPEMNEEAKAFTAAWEKEYPGKAPNANAAMGYDAYVLLYQAIVRANSAEPGAIRDALETTKDVATVTGLTSFSPEKHDPVKDLGVVEIKDGKKSYIYTVKP

📊 Sample Types

Isolate 15.1%
Metagenome 84.2%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 28.1%
Termitidae 23.4%
Kalotermitidae 20.3%
Unclassified 14.1%
Termopsidae 6.2%
Rhinotermitidae 3.1%
Passalidae 3.1%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2751185856 Bartonella apis BBC0244 Isolate Apidae
2 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 8073617375 Bartonella apis W8098 Isolate Apidae
10 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 8068946563 Bartonella apihabitans M0187 Isolate Apidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
23 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 8068950955 Bartonella apihabitans W8097 Isolate Apidae
26 8073621894 Bartonella apis W8099 Isolate Apidae
27 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 8073624232 Bartonella sp. W8151 Isolate Apidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2751185853 Bartonella apis BBC0178 Isolate Apidae
39 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
40 8068944069 Bartonella choladocola W8125 Isolate Apidae
41 8068955631 Bartonella apihabitans M0280 Isolate Apidae
42 8073628750 Bartonella sp. W8167 Isolate Apidae
43 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
44 2820070515 Unclassified Proteobacteria Nt197P3bin137 Isolate Unclassified
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
47 8068953321 Bartonella apihabitans M0190 Isolate Apidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
52 2820008971 Unclassified Synergistetes Lab288P3bin103 Isolate Unclassified
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 8073626464 Bartonella apis W8152 Isolate Apidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 2751185858 Bartonella apis BBC0122 Isolate Apidae
59 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
60 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
61 8073619611 Bartonella apis B10834G6 Isolate Apidae
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_014680 3300042659 Bacteria 114664
2 Ga0466733_168770 3300042659 Bacteria 6229
3 Ga0466700_035902 3300042600 Bacteria 2003
4 Ga0466722_090339 3300042609 Bacteria 6682
5 Ga0466711_003108 3300042615 Bacteria 3446
6 Ga0466704_258288 3300042643 Bacteria 5884
7 Ga0068302_10131016 3300005071 Bacteria 5390
8 Ga0466707_046444 3300042601 Bacteria 2457
9 Ga0466707_172064 3300042601 Bacteria 1616
10 Ga0466711_002672 3300042615 Bacteria 1528
11 Ga0466711_013700 3300042615 Bacteria 7272
12 Ga0466711_054743 3300042615 Bacteria 26049
13 Ga0466715_095578 3300042616 Bacteria 6097
14 Ga0466715_221895 3300042616 Bacteria 5034
15 Ga0466715_637826 3300042616 Bacteria 19151
16 Ga0466723_080370 3300042618 Unclassified 2998
17 Ga0466726_282320 3300042619 Bacteria 3108
18 Ga0466695_076190 3300042595 Bacteria 4696
19 Ga0466696_027534 3300042596 Bacteria 1755
20 Ga0466729_215052 3300042621 Bacteria 2943
21 Ga0466729_254283 3300042621 Bacteria 1982
22 Ga0466704_055141 3300042643 Bacteria 13569
23 Ga0466704_267199 3300042643 Bacteria 5213
24 Ga0074278_145866 3300005721 Bacteria 8886
25 Ga0466706_142417 3300042599 Bacteria 6125
26 Ga0466716_480658 3300042605 Bacteria 6822
27 Ga0466716_484189 3300042605 Bacteria 2187
28 Ga0466715_028516 3300042616 Bacteria 46466
29 Ga0466715_083420 3300042616 Bacteria 2967
30 Ga0466723_335802 3300042618 Bacteria 3139
31 Ga0415639_002265 3300038395 Unclassified 5928
32 Ga0466696_064237 3300042596 Bacteria 1391
33 Ga0466731_170179 3300042622 Bacteria 2987
34 Ga0466735_155383 3300042624 Bacteria 2479
35 Ga0466735_187003 3300042624 Bacteria 1302
36 Ga0466703_315948 3300042636 Bacteria 31854
37 Ga0466709_339020 3300042648 Bacteria 2255
38 Ga0466708_159451 3300042652 Bacteria 10680
39 Ga0466708_221580 3300042652 Bacteria 6724
40 Ga0466708_419719 3300042652 Unclassified 8334
41 Ga0466727_045354 3300042655 Bacteria 19099
42 Ga0466727_101670 3300042655 Bacteria 2034
43 Ga0123353_10318126 3300010167 Bacteria 2364
44 Ga0123353_10610369 3300010167 Bacteria 1556
45 Ga0466705_396553 3300042612 Bacteria 12904
46 Ga0466711_154349 3300042615 Bacteria 8908
47 Ga0466711_238265 3300042615 Bacteria 6972
48 Ga0466711_316967 3300042615 Bacteria 14171
49 Ga0466715_038024 3300042616 Bacteria 21629
50 Ga0466726_106223 3300042619 Bacteria 25972
51 Ga0466726_398770 3300042619 Bacteria 1972
52 Ga0466690_285216 3300042590 Bacteria 9418
53 Ga0466691_027465 3300042593 Bacteria 5505
54 Ga0466696_246082 3300042596 Bacteria 10175
55 Ga0466735_121112 3300042624 Bacteria 1942
56 Ga0466709_125270 3300042648 Bacteria 2073
57 Ga0466708_252247 3300042652 Bacteria 13096
58 Ga0466708_318765 3300042652 Bacteria 20247
59 Ga0466727_110756 3300042655 Bacteria 1360
60 2227544365 2225789004 Bacteria 2944
61 HBC_ctgsDRAFT_1004739 3300000333 Bacteria 3163
62 Ga0068302_10156384 3300005071 Bacteria 1543
63 Ga0072940_1006156 3300005200 Bacteria 3690
64 Ga0123353_10152555 3300010167 Bacteria 3687
65 Ga0466717_211749 3300042604 Bacteria 1686
66 Ga0466722_110984 3300042609 Bacteria 13357
67 Ga0466722_130308 3300042609 Bacteria 26514
68 Ga0466705_432449 3300042612 Bacteria 14311
69 Ga0466705_505432 3300042612 Bacteria 3685
70 Ga0466710_208070 3300042613 Bacteria 1197
71 Ga0466711_433844 3300042615 Bacteria 5210
72 Ga0466715_039865 3300042616 Bacteria 13769
73 Ga0466723_310735 3300042618 Unclassified 3874
74 Ga0466726_457698 3300042619 Bacteria 20122
75 Ga0466691_102157 3300042593 Bacteria 23256
76 Ga0466691_110751 3300042593 Bacteria 24397
77 HBC_ctgsDRAFT_1021878 3300000333 Unclassified 1563
78 JGI24702J35022_10096352 3300002462 Bacteria 1615
79 Ga0074278_119752 3300005721 Unclassified 12253
80 Ga0466705_065028 3300042612 Bacteria 59479
81 Ga0466705_306469 3300042612 Bacteria 7706
82 Ga0466733_214740 3300042659 Bacteria 1966
83 Ga0466713_101428 3300042602 Bacteria 57232
84 Ga0466698_435059 3300042610 Bacteria 1337
85 Ga0466715_334947 3300042616 Bacteria 2375
86 Ga0466723_143698 3300042618 Bacteria 12983
87 Ga0466723_179257 3300042618 Bacteria 23089
88 Ga0466726_170858 3300042619 Bacteria 2859
89 Ga0466728_367452 3300042620 Bacteria 16793
90 Ga0466691_110053 3300042593 Bacteria 10258
91 Ga0466691_197825 3300042593 Bacteria 1912
92 Ga0466696_262354 3300042596 Bacteria 12032
93 Ga0466703_071589 3300042636 Bacteria 34836
94 Ga0466708_069298 3300042652 Bacteria 43214
95 Ga0466727_104770 3300042655 Bacteria 6139
96 Ga0466705_180227 3300042612 Bacteria 8558
97 Ga0466733_094789 3300042659 Bacteria 17142
98 Ga0466714_074823 3300042603 Bacteria 4990
99 Ga0466711_005843 3300042615 Bacteria 16443
100 Ga0466711_192192 3300042615 Unclassified 2826
101 Ga0466711_267578 3300042615 Bacteria 10397
102 Ga0466715_016537 3300042616 Bacteria 14222
103 Ga0466715_400863 3300042616 Bacteria 7696
104 Ga0255809_1021784 3300022820 Bacteria 1569
105 Ga0466704_116765 3300042643 Bacteria 12043
106 Ga0466705_270203 3300042612 Bacteria 6690
107 Ga0466727_351869 3300042655 Bacteria 6844
108 Ga0123356_10165753 3300010049 Bacteria 2213
109 Ga0123353_10040951 3300010167 Bacteria 7313
110 Ga0466707_125939 3300042601 Bacteria 6291
111 Ga0466713_011190 3300042602 Bacteria 84941
112 Ga0466722_104466 3300042609 Bacteria 1767
113 Ga0466698_044961 3300042610 Bacteria 3350
114 Ga0466711_166223 3300042615 Bacteria 11678
115 Ga0466711_496515 3300042615 Bacteria 2715
116 Ga0466715_384655 3300042616 Bacteria 3694
117 Ga0466723_278144 3300042618 Bacteria 1717
118 Ga0466728_024846 3300042620 Bacteria 1876
119 Ga0415639_153446 3300038395 Bacteria 2087
120 Ga0466703_389995 3300042636 Bacteria 1690
121 Ga0466709_352248 3300042648 Bacteria 4811
122 Ga0466708_038735 3300042652 Bacteria 11450
123 Ga0466708_415087 3300042652 Bacteria 5807
124 Ga0466725_174884 3300042654 Bacteria 1768
125 2227108569 2225789004 Bacteria 39179
126 IMNBL1DRAFT_c0035947 3300000062 Bacteria 1738
127 Ga0074278_114727 3300005721 Unclassified 19922

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13458 Peripla_BP_6 Periplasmic binding protein 94 436 0.94
PF01094 ANF_receptor Receptor family ligand binding region 126 405 0.86
PF13433 Peripla_BP_5 Periplasmic binding protein domain 95 433 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.