Protein Family IF05972
Metagenome
Isolate
119
Members
41
Samples
118
Scaffolds
296.04
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_352499|Ga0466707_352499_609_1589
- Length
- 326 aa
- Sequence
- MSHIANRTWKGNTGGGTLGQRLLIFFFRWWNLRLGYAIMAVVVPFYMLFARKGYLAIYHYFRQQHGFSKWKSFRKTYRNHFLFGQVILDRFAVFSGRRGDFEVEIVGNEHFQRLCNGEKGFVIVGSHVGNFEIAGYLLGQDKKRINALIFGGETATVQQNRSKVLNNNNVNLIPVSADMSHLFAANVALQNGEIVSMPADRVFGSAKSVECDFLNGKADFPVGAFALAASLEVEALAIFCIKISAKRYKIFVQLVSVCHCGLGYRAKSKYDPQSPESKGDSDFHQNDRKKQIANLAKAYVVELEKIVTQYPEQWFNFYEFWKSSEL
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.1%
Termitidae
31.7%
Unclassified
9.8%
Termopsidae
9.8%
Rhinotermitidae
7.3%
Passalidae
4.9%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 12 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466704_322171 | 3300042643 | Bacteria | 8368 |
| 2 | Ga0466704_322472 | 3300042643 | Bacteria | 3162 |
| 3 | Ga0466704_343880 | 3300042643 | Bacteria | 4222 |
| 4 | Ga0466704_565068 | 3300042643 | Bacteria | 14460 |
| 5 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 6 | Ga0466708_455953 | 3300042652 | Bacteria | 1901 |
| 7 | 2227502413 | 2225789004 | Bacteria | 19081 |
| 8 | JGI24705J35276_12235187 | 3300002504 | Bacteria | 6268 |
| 9 | Ga0123357_10426605 | 3300009784 | Bacteria | 1177 |
| 10 | Ga0466690_153086 | 3300042590 | Bacteria | 2408 |
| 11 | Ga0466691_148747 | 3300042593 | Bacteria | 15449 |
| 12 | Ga0466706_190648 | 3300042599 | Bacteria | 33307 |
| 13 | Ga0466707_285997 | 3300042601 | Bacteria | 2276 |
| 14 | Ga0466713_114133 | 3300042602 | Bacteria | 18530 |
| 15 | Ga0466726_242969 | 3300042619 | Bacteria | 2037 |
| 16 | Ga0466726_263213 | 3300042619 | Unclassified | 1306 |
| 17 | Ga0466726_419621 | 3300042619 | Bacteria | 4688 |
| 18 | Ga0466728_138171 | 3300042620 | Bacteria | 48750 |
| 19 | Ga0466705_264324 | 3300042612 | Bacteria | 17030 |
| 20 | Ga0466733_042701 | 3300042659 | Bacteria | 7371 |
| 21 | Ga0466727_067939 | 3300042655 | Bacteria | 1625 |
| 22 | Ga0466727_120065 | 3300042655 | Bacteria | 6775 |
| 23 | Ga0466727_139855 | 3300042655 | Bacteria | 1514 |
| 24 | Ga0068305_10921901 | 3300005083 | Bacteria | 4315 |
| 25 | Ga0466700_193309 | 3300042600 | Bacteria | 37158 |
| 26 | Ga0466713_033344 | 3300042602 | Bacteria | 37079 |
| 27 | Ga0466713_110191 | 3300042602 | Bacteria | 1850 |
| 28 | Ga0466714_007204 | 3300042603 | Bacteria | 3156 |
| 29 | Ga0466716_340092 | 3300042605 | Bacteria | 13961 |
| 30 | Ga0466719_009948 | 3300042606 | Bacteria | 7289 |
| 31 | Ga0466719_449519 | 3300042606 | Bacteria | 14404 |
| 32 | Ga0466711_165052 | 3300042615 | Bacteria | 2666 |
| 33 | Ga0466715_342363 | 3300042616 | Bacteria | 29081 |
| 34 | Ga0466723_025842 | 3300042618 | Bacteria | 14881 |
| 35 | Ga0466723_233898 | 3300042618 | Bacteria | 28559 |
| 36 | Ga0466728_161462 | 3300042620 | Bacteria | 1091 |
| 37 | Ga0466705_372726 | 3300042612 | Bacteria | 12512 |
| 38 | Ga0466703_173935 | 3300042636 | Bacteria | 16868 |
| 39 | Ga0466703_217268 | 3300042636 | Bacteria | 30172 |
| 40 | Ga0466703_418661 | 3300042636 | Bacteria | 1739 |
| 41 | Ga0466704_102498 | 3300042643 | Bacteria | 21970 |
| 42 | Ga0466709_279583 | 3300042648 | Bacteria | 6500 |
| 43 | Ga0466709_286457 | 3300042648 | Bacteria | 7521 |
| 44 | Ga0068305_10078188 | 3300005083 | Bacteria | 1630 |
| 45 | Ga0123357_10117989 | 3300009784 | Bacteria | 3355 |
| 46 | Ga0123356_10773617 | 3300010049 | Bacteria | 1131 |
| 47 | Ga0466657_249935 | 3300042582 | Unclassified | 1677 |
| 48 | Ga0466692_078297 | 3300042591 | Bacteria | 14149 |
| 49 | Ga0466706_237718 | 3300042599 | Bacteria | 1235 |
| 50 | Ga0466716_345506 | 3300042605 | Bacteria | 2857 |
| 51 | Ga0466716_355646 | 3300042605 | Bacteria | 19620 |
| 52 | Ga0466719_304807 | 3300042606 | Bacteria | 2115 |
| 53 | Ga0466715_340747 | 3300042616 | Bacteria | 15029 |
| 54 | Ga0466715_443592 | 3300042616 | Bacteria | 6540 |
| 55 | Ga0466723_030880 | 3300042618 | Bacteria | 5193 |
| 56 | Ga0466723_271659 | 3300042618 | Bacteria | 24829 |
| 57 | Ga0466728_149086 | 3300042620 | Bacteria | 2769 |
| 58 | Ga0466705_130431 | 3300042612 | Bacteria | 14655 |
| 59 | Ga0466705_158758 | 3300042612 | Bacteria | 11045 |
| 60 | Ga0466709_315607 | 3300042648 | Bacteria | 6478 |
| 61 | Ga0466708_085174 | 3300042652 | Bacteria | 23155 |
| 62 | Ga0466708_347084 | 3300042652 | Bacteria | 11166 |
| 63 | JGI24696J40584_12959541 | 3300002834 | Bacteria | 5263 |
| 64 | Ga0068302_10317979 | 3300005071 | Bacteria | 1320 |
| 65 | Ga0123354_10011041 | 3300010882 | Bacteria | 13936 |
| 66 | Ga0466706_280280 | 3300042599 | Bacteria | 34158 |
| 67 | Ga0466716_202600 | 3300042605 | Bacteria | 25648 |
| 68 | Ga0466716_423070 | 3300042605 | Bacteria | 2061 |
| 69 | Ga0466719_158323 | 3300042606 | Bacteria | 1449 |
| 70 | Ga0466711_468146 | 3300042615 | Bacteria | 29475 |
| 71 | Ga0466715_440572 | 3300042616 | Bacteria | 3452 |
| 72 | Ga0466728_046855 | 3300042620 | Bacteria | 21751 |
| 73 | Ga0466735_053315 | 3300042624 | Bacteria | 11454 |
| 74 | Ga0466703_384067 | 3300042636 | Bacteria | 3714 |
| 75 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 76 | Ga0466704_094724 | 3300042643 | Bacteria | 10795 |
| 77 | Ga0466704_469314 | 3300042643 | Bacteria | 1383 |
| 78 | Ga0466690_202381 | 3300042590 | Bacteria | 5525 |
| 79 | Ga0466692_205318 | 3300042591 | Bacteria | 6340 |
| 80 | Ga0466696_251909 | 3300042596 | Bacteria | 7596 |
| 81 | Ga0466719_217250 | 3300042606 | Bacteria | 1384 |
| 82 | Ga0466711_338621 | 3300042615 | Bacteria | 11912 |
| 83 | IMNBL1DRAFT_c0002369 | 3300000062 | Bacteria | 13182 |
| 84 | Ga0466693_272559 | 3300042592 | Bacteria | 1440 |
| 85 | Ga0466691_058246 | 3300042593 | Bacteria | 14754 |
| 86 | Ga0466707_103534 | 3300042601 | Bacteria | 2223 |
| 87 | Ga0466722_150720 | 3300042609 | Bacteria | 8542 |
| 88 | Ga0466722_234933 | 3300042609 | Bacteria | 3641 |
| 89 | Ga0466704_366088 | 3300042643 | Unclassified | 4810 |
| 90 | IMNBL1DRAFT_c0004635 | 3300000062 | Bacteria | 8172 |
| 91 | Ga0072940_1244072 | 3300005200 | Bacteria | 2111 |
| 92 | Ga0123357_10039887 | 3300009784 | Bacteria | 6393 |
| 93 | Ga0466690_015023 | 3300042590 | Bacteria | 27335 |
| 94 | Ga0466690_147695 | 3300042590 | Bacteria | 7532 |
| 95 | Ga0466690_409142 | 3300042590 | Bacteria | 5724 |
| 96 | Ga0466691_191216 | 3300042593 | Bacteria | 6785 |
| 97 | Ga0466691_194715 | 3300042593 | Bacteria | 2878 |
| 98 | Ga0466701_075789 | 3300042598 | Bacteria | 4653 |
| 99 | Ga0466713_092950 | 3300042602 | Bacteria | 117604 |
| 100 | Ga0466715_232040 | 3300042616 | Bacteria | 3467 |
| 101 | Ga0466728_281160 | 3300042620 | Bacteria | 13069 |
| 102 | Ga0466728_333383 | 3300042620 | Bacteria | 8910 |
| 103 | Ga0466729_157892 | 3300042621 | Bacteria | 5818 |
| 104 | Ga0466703_311997 | 3300042636 | Bacteria | 13194 |
| 105 | Ga0466704_156837 | 3300042643 | Bacteria | 12573 |
| 106 | IMNBL1DRAFT_c0010407 | 3300000062 | Bacteria | 4457 |
| 107 | JGI24702J35022_10011745 | 3300002462 | Bacteria | 4879 |
| 108 | JGI24702J35022_10020359 | 3300002462 | Bacteria | 3602 |
| 109 | Ga0466690_045391 | 3300042590 | Bacteria | 5444 |
| 110 | Ga0466690_051493 | 3300042590 | Bacteria | 11140 |
| 111 | Ga0466696_024005 | 3300042596 | Bacteria | 8939 |
| 112 | Ga0466706_196261 | 3300042599 | Bacteria | 6844 |
| 113 | Ga0466707_352499 | 3300042601 | Bacteria | 5876 |
| 114 | Ga0466716_030847 | 3300042605 | Bacteria | 18551 |
| 115 | Ga0466716_475844 | 3300042605 | Bacteria | 2497 |
| 116 | Ga0466722_007385 | 3300042609 | Bacteria | 1937 |
| 117 | Ga0466722_059383 | 3300042609 | Bacteria | 11770 |
| 118 | Ga0466715_604151 | 3300042616 | Bacteria | 27450 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03279 | Lip_A_acyltrans | Bacterial lipid A biosynthesis acyltransferase | 94 | 322 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.