Protein Family IF05899
Metagenome
Isolate
161
Members
52
Samples
149
Scaffolds
575.65
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_214192|Ga0466707_214192_1215_3182
- Length
- 655 aa
- Sequence
- MPACREENFHRWQVPALDAENGAGSGEGRFPGDTEMFAPEAVGRLRGDFWFFIRVIVHELYLTFYCFSGYSSITMKTLTGVPVSPGIVIGKAFRYVENDFPEIPRYTLRKTQVESELKRLDNSRAAAMDEVKALNERAVKEMSKDQADIFAAHLMMLEDPDFHDQIAAQIKDNLRNAEWAIWEIARNITQKMRSSPDPVFRERAVDITDVCKRVLLHLLSVKKVSLADLDEDVIVVARDLLPSDTLIMNKEHVKAIAMDMGGRTSHTAILARAFNIPAVLGLSTASNEIADGDALVLDGSAGQVFVNPDKKYLDKYQKADDLYRKKIDAFMGLRDLPAETKDGYRVSLKANIEIPEEVDQVLLCGAEGIGLYRSEFLFLTPGKAAGEEFQFESYSRVLRSMGDRPVTIRTVDIGGDKILPDFQSADEKNPLLGWRAIRFSLALPALFKTQLRAILRASVFGNVRIMFPLISGIEELEQALALLKEAKEECRKKGQAFAENIEVGTMIEVPSAAITSDILAKKSDFFSIGTNDLIQYSLAVDRGNEKVSYLARPSHPAVLRFLRMIIGNAHAKGIKAAMCGEMAGDPMGTVLLLGMGLDEFSMSASAIPQIKNIVRGVTIEECRALYEKVMQSTSIRENADLIKSWMAEHLPSVII
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.7%
Unclassified
26.9%
Kalotermitidae
26.9%
Termopsidae
7.7%
Rhinotermitidae
5.8%
Taxonomy
Archaea
0
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 12 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 21 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 48 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_312525 | 3300042612 | Bacteria | 10723 |
| 2 | Ga0466716_002335 | 3300042605 | Bacteria | 3365 |
| 3 | Ga0466719_016908 | 3300042606 | Bacteria | 25606 |
| 4 | Ga0466722_045861 | 3300042609 | Bacteria | 10108 |
| 5 | Ga0466722_179456 | 3300042609 | Bacteria | 2831 |
| 6 | Ga0466712_175504 | 3300042614 | Unclassified | 13590 |
| 7 | Ga0466715_072917 | 3300042616 | Bacteria | 12980 |
| 8 | Ga0466715_212807 | 3300042616 | Bacteria | 12949 |
| 9 | Ga0466723_005329 | 3300042618 | Bacteria | 28572 |
| 10 | Ga0466723_215602 | 3300042618 | Bacteria | 5223 |
| 11 | Ga0466726_232584 | 3300042619 | Bacteria | 5232 |
| 12 | Ga0466728_271596 | 3300042620 | Bacteria | 18649 |
| 13 | Ga0415639_136622 | 3300038395 | Bacteria | 3023 |
| 14 | Ga0415639_141985 | 3300038395 | Bacteria | 2296 |
| 15 | Ga0466692_018965 | 3300042591 | Bacteria | 10438 |
| 16 | Ga0466692_056617 | 3300042591 | Bacteria | 76518 |
| 17 | Ga0466691_002031 | 3300042593 | Bacteria | 7751 |
| 18 | Ga0466695_163176 | 3300042595 | Bacteria | 5128 |
| 19 | Ga0466696_359562 | 3300042596 | Bacteria | 4645 |
| 20 | Ga0123353_10010583 | 3300010167 | Bacteria | 12875 |
| 21 | Ga0466735_071348 | 3300042624 | Bacteria | 7834 |
| 22 | Ga0466704_462373 | 3300042643 | Bacteria | 10715 |
| 23 | Ga0466709_348027 | 3300042648 | Bacteria | 20838 |
| 24 | Ga0466727_042532 | 3300042655 | Bacteria | 5085 |
| 25 | JGI24698J34947_10009614 | 3300002449 | Bacteria | 5298 |
| 26 | Ga0068302_10121394 | 3300005071 | Bacteria | 2918 |
| 27 | Ga0466705_009915 | 3300042612 | Bacteria | 2842 |
| 28 | Ga0466732_092153 | 3300042656 | Bacteria | 3710 |
| 29 | Ga0466716_188036 | 3300042605 | Bacteria | 2670 |
| 30 | Ga0466716_302662 | 3300042605 | Bacteria | 2910 |
| 31 | Ga0466719_213278 | 3300042606 | Bacteria | 2335 |
| 32 | Ga0466722_017371 | 3300042609 | Bacteria | 5764 |
| 33 | Ga0466718_112058 | 3300042617 | Bacteria | 11480 |
| 34 | Ga0466723_116854 | 3300042618 | Bacteria | 11347 |
| 35 | Ga0466726_056035 | 3300042619 | Bacteria | 9100 |
| 36 | Ga0466726_350788 | 3300042619 | Bacteria | 4687 |
| 37 | Ga0466728_344222 | 3300042620 | Bacteria | 2913 |
| 38 | Ga0466728_439815 | 3300042620 | Bacteria | 7474 |
| 39 | Ga0466703_349274 | 3300042636 | Bacteria | 11222 |
| 40 | Ga0466703_408842 | 3300042636 | Bacteria | 3039 |
| 41 | Ga0466704_046426 | 3300042643 | Bacteria | 12722 |
| 42 | Ga0466704_052682 | 3300042643 | Bacteria | 4405 |
| 43 | Ga0466708_230858 | 3300042652 | Bacteria | 2319 |
| 44 | AustNasuHG_c1002011 | 3300000089 | Bacteria | 7316 |
| 45 | AustNasuHG_c1008991 | 3300000089 | Bacteria | 3525 |
| 46 | Ga0466722_018164 | 3300042609 | Bacteria | 5235 |
| 47 | Ga0466718_101250 | 3300042617 | Bacteria | 9987 |
| 48 | Ga0466723_125571 | 3300042618 | Bacteria | 13230 |
| 49 | Ga0466728_082707 | 3300042620 | Bacteria | 5641 |
| 50 | Ga0466694_069940 | 3300042594 | Bacteria | 18221 |
| 51 | Ga0123357_10094647 | 3300009784 | Bacteria | 3877 |
| 52 | Ga0123353_10006784 | 3300010167 | Bacteria | 15345 |
| 53 | Ga0123353_10057148 | 3300010167 | Bacteria | 6248 |
| 54 | Ga0466703_050269 | 3300042636 | Bacteria | 11417 |
| 55 | Ga0466727_045188 | 3300042655 | Bacteria | 14134 |
| 56 | Ga0466700_103650 | 3300042600 | Bacteria | 2862 |
| 57 | Ga0466719_092037 | 3300042606 | Unclassified | 11577 |
| 58 | Ga0466711_002121 | 3300042615 | Bacteria | 18676 |
| 59 | Ga0466715_538922 | 3300042616 | Bacteria | 7468 |
| 60 | Ga0466726_440412 | 3300042619 | Bacteria | 4923 |
| 61 | Ga0466691_156921 | 3300042593 | Bacteria | 5137 |
| 62 | Ga0123353_10079709 | 3300010167 | Unclassified | 5266 |
| 63 | Ga0466727_129646 | 3300042655 | Bacteria | 3342 |
| 64 | JGI24698J34947_10011214 | 3300002449 | Bacteria | 4920 |
| 65 | Ga0072940_1055102 | 3300005200 | Bacteria | 8923 |
| 66 | Ga0466705_271299 | 3300042612 | Bacteria | 3184 |
| 67 | Ga0466707_260807 | 3300042601 | Bacteria | 7492 |
| 68 | Ga0466719_446752 | 3300042606 | Bacteria | 15390 |
| 69 | Ga0466722_056894 | 3300042609 | Bacteria | 11763 |
| 70 | Ga0466711_102145 | 3300042615 | Bacteria | 6541 |
| 71 | Ga0466715_146831 | 3300042616 | Bacteria | 7159 |
| 72 | Ga0466715_154529 | 3300042616 | Bacteria | 10631 |
| 73 | Ga0466715_265064 | 3300042616 | Bacteria | 7663 |
| 74 | Ga0466715_282103 | 3300042616 | Bacteria | 7523 |
| 75 | Ga0466715_425928 | 3300042616 | Bacteria | 11513 |
| 76 | Ga0466723_092560 | 3300042618 | Bacteria | 15560 |
| 77 | Ga0466723_231783 | 3300042618 | Bacteria | 2354 |
| 78 | Ga0466726_073298 | 3300042619 | Bacteria | 6761 |
| 79 | Ga0466726_094421 | 3300042619 | Bacteria | 2564 |
| 80 | Ga0466726_365625 | 3300042619 | Bacteria | 7078 |
| 81 | Ga0466728_151261 | 3300042620 | Bacteria | 2809 |
| 82 | Ga0456237_0000441 | 3300041968 | Bacteria | 6279 |
| 83 | Ga0466691_144782 | 3300042593 | Bacteria | 35149 |
| 84 | Ga0466694_125160 | 3300042594 | Bacteria | 2877 |
| 85 | Ga0123353_10187643 | 3300010167 | Bacteria | 3267 |
| 86 | Ga0466703_076849 | 3300042636 | Bacteria | 11625 |
| 87 | Ga0466704_392106 | 3300042643 | Bacteria | 4387 |
| 88 | Ga0466708_139430 | 3300042652 | Bacteria | 31102 |
| 89 | Ga0466708_192017 | 3300042652 | Bacteria | 15149 |
| 90 | JGI24698J34947_10000374 | 3300002449 | Bacteria | 20110 |
| 91 | JGI24698J34947_10038758 | 3300002449 | Bacteria | 2471 |
| 92 | Ga0466705_019875 | 3300042612 | Unclassified | 5611 |
| 93 | Ga0466707_076747 | 3300042601 | Bacteria | 3379 |
| 94 | Ga0466716_346191 | 3300042605 | Bacteria | 2377 |
| 95 | Ga0466712_087469 | 3300042614 | Bacteria | 25984 |
| 96 | Ga0466711_066253 | 3300042615 | Bacteria | 2247 |
| 97 | Ga0466711_274465 | 3300042615 | Bacteria | 3352 |
| 98 | Ga0466718_044407 | 3300042617 | Bacteria | 5520 |
| 99 | Ga0466723_018977 | 3300042618 | Bacteria | 4229 |
| 100 | Ga0466690_110649 | 3300042590 | Bacteria | 6912 |
| 101 | Ga0466690_416334 | 3300042590 | Bacteria | 10414 |
| 102 | Ga0466691_221998 | 3300042593 | Bacteria | 17632 |
| 103 | Ga0466694_395046 | 3300042594 | Bacteria | 4479 |
| 104 | Ga0466696_140033 | 3300042596 | Bacteria | 18405 |
| 105 | Ga0466735_007205 | 3300042624 | Bacteria | 11086 |
| 106 | Ga0466704_180890 | 3300042643 | Bacteria | 2286 |
| 107 | Ga0466709_272350 | 3300042648 | Bacteria | 8225 |
| 108 | JGI24702J35022_10002778 | 3300002462 | Bacteria | 10624 |
| 109 | Ga0466705_032693 | 3300042612 | Bacteria | 10420 |
| 110 | Ga0466707_214192 | 3300042601 | Bacteria | 3600 |
| 111 | Ga0466722_017372 | 3300042609 | Bacteria | 5112 |
| 112 | Ga0466712_173542 | 3300042614 | Bacteria | 5099 |
| 113 | Ga0466715_030638 | 3300042616 | Bacteria | 4899 |
| 114 | Ga0466723_133765 | 3300042618 | Bacteria | 16255 |
| 115 | Ga0466726_011212 | 3300042619 | Bacteria | 3360 |
| 116 | Ga0466694_323088 | 3300042594 | Bacteria | 4434 |
| 117 | Ga0466696_066950 | 3300042596 | Bacteria | 12418 |
| 118 | Ga0466696_429955 | 3300042596 | Bacteria | 3529 |
| 119 | Ga0123357_10079672 | 3300009784 | Bacteria | 4311 |
| 120 | Ga0466735_110691 | 3300042624 | Unclassified | 2887 |
| 121 | Ga0466703_054332 | 3300042636 | Bacteria | 3186 |
| 122 | Ga0466703_064058 | 3300042636 | Bacteria | 7213 |
| 123 | Ga0466703_136925 | 3300042636 | Bacteria | 3407 |
| 124 | Ga0466704_004653 | 3300042643 | Bacteria | 6276 |
| 125 | Ga0466704_067564 | 3300042643 | Bacteria | 49390 |
| 126 | Ga0466727_279909 | 3300042655 | Bacteria | 2440 |
| 127 | JGI24698J34947_10000389 | 3300002449 | Bacteria | 19820 |
| 128 | JGI24698J34947_10001286 | 3300002449 | Bacteria | 13140 |
| 129 | JGI24700J35501_10926122 | 3300002508 | Bacteria | 6105 |
| 130 | Ga0068305_10160442 | 3300005083 | Bacteria | 9013 |
| 131 | Ga0466705_275077 | 3300042612 | Bacteria | 2554 |
| 132 | Ga0466719_324975 | 3300042606 | Bacteria | 11895 |
| 133 | Ga0466712_089353 | 3300042614 | Bacteria | 4168 |
| 134 | Ga0466723_002457 | 3300042618 | Bacteria | 13923 |
| 135 | Ga0466726_395283 | 3300042619 | Bacteria | 3782 |
| 136 | Ga0466726_472349 | 3300042619 | Bacteria | 4423 |
| 137 | Ga0466728_131268 | 3300042620 | Bacteria | 4181 |
| 138 | Ga0456237_0000506 | 3300041968 | Bacteria | 5952 |
| 139 | Ga0466693_110587 | 3300042592 | Bacteria | 7401 |
| 140 | Ga0466694_019202 | 3300042594 | Bacteria | 3575 |
| 141 | Ga0123355_10000434 | 3300009826 | Bacteria | 54971 |
| 142 | Ga0123355_10019889 | 3300009826 | Bacteria | 10699 |
| 143 | Ga0123353_10140739 | 3300010167 | Bacteria | 3865 |
| 144 | Ga0466735_048323 | 3300042624 | Bacteria | 3913 |
| 145 | Ga0466709_356051 | 3300042648 | Bacteria | 4992 |
| 146 | Ga0466708_081148 | 3300042652 | Bacteria | 13881 |
| 147 | Ga0466727_247562 | 3300042655 | Bacteria | 1982 |
| 148 | JGI24698J34947_10002274 | 3300002449 | Bacteria | 10304 |
| 149 | JGI24696J40584_12958680 | 3300002834 | Bacteria | 4323 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05524 | GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.