Protein Family IF05864

Metagenome Isolate
135 Members
35 Samples
130 Scaffolds
115.56 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_164223|Ga0466707_164223_333_728
Length
131 aa
Sequence
MVDGVPMQGDIIKINLDPKKGHEQAGYRPYICLSNKVISDYANIAVFAPISNTKRQYPLYIPLPDHSDQGLRSADKPLQGQTTGAILLDQIVTIDYNARQFRYIETVSPGFLKNLLDTVVLIFQKNEDTGK

📊 Sample Types

Isolate 3.7%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.7%
Unclassified 20.6%
Termopsidae 5.9%
Tenebrionidae 2.9%
Kalotermitidae 2.9%
Rhinotermitidae 2.9%

🌳 Taxonomy

Archaea 2
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
15 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
24 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
25 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 2228664018 Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 Metagenome Termitidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_094203 3300038395 Bacteria 874
2 Ga0466699_331554 3300042597 Bacteria 1713
3 JGI24698J34947_10006420 3300002449 Bacteria 6455
4 JGI24698J34947_10018096 3300002449 Unclassified 3812
5 JGI24698J34947_10029925 3300002449 Bacteria 2874
6 JGI24698J34947_10258572 3300002449 Bacteria 646
7 JGI24695J34938_10160154 3300002450 Unclassified 925
8 Ga0072941_1003248 3300005201 Bacteria 8846
9 Ga0123355_10453195 3300009826 Bacteria 1615
10 Ga0123356_10198041 3300010049 Bacteria 2046
11 Ga0123356_11781555 3300010049 Bacteria 765
12 Ga0123356_12420320 3300010049 Bacteria 657
13 Ga0123353_10144554 3300010167 Unclassified 3805
14 Ga0123354_10882175 3300010882 Bacteria 589
15 Ga0466712_024607 3300042614 Bacteria 1670
16 Ga0466712_128645 3300042614 Unclassified 2337
17 Ga0466728_470408 3300042620 Bacteria 1099
18 Ga0466713_056291 3300042602 Bacteria 2162
19 Ga0466717_221571 3300042604 Bacteria 2236
20 Ga0415639_105717 3300038395 Bacteria 1056
21 Ga0466699_126698 3300042597 Unclassified 4579
22 JGI24698J34947_10017714 3300002449 Bacteria 3857
23 JGI24698J34947_10071583 3300002449 Bacteria 1664
24 JGI24698J34947_10265340 3300002449 Bacteria 634
25 JGI24695J34938_10009751 3300002450 Bacteria 5316
26 JGI24695J34938_10011355 3300002450 Bacteria 4803
27 JGI24695J34938_10015396 3300002450 Bacteria 3925
28 Ga0072941_1450353 3300005201 Bacteria 1074
29 Ga0123355_10819501 3300009826 Bacteria 1033
30 Ga0123356_10050704 3300010049 Bacteria 3861
31 Ga0123356_13036684 3300010049 Bacteria 586
32 Ga0123356_13123972 3300010049 Bacteria 577
33 Ga0123353_10003566 3300010167 Bacteria 19707
34 Ga0466702_184620 3300042635 Bacteria 1080
35 Ga0466702_353297 3300042635 Bacteria 1097
36 JGI24698J34947_10015661 3300002449 Bacteria 4126
37 JGI24698J34947_10087842 3300002449 Unclassified 1436
38 JGI24698J34947_10121855 3300002449 Unclassified 1130
39 JGI24698J34947_10349480 3300002449 Bacteria 518
40 JGI24695J34938_10142549 3300002450 Unclassified 979
41 JGI24696J40584_12958210 3300002834 Bacteria 3964
42 Ga0123356_10032741 3300010049 Unclassified 4861
43 Ga0123356_10847784 3300010049 Bacteria 1085
44 Ga0123356_11445119 3300010049 Unclassified 847
45 Ga0123356_12029865 3300010049 Bacteria 717
46 Ga0123353_11147473 3300010167 Bacteria 1026
47 Ga0466712_246425 3300042614 Bacteria 9475
48 Ga0466726_131561 3300042619 Bacteria 4637
49 Ga0466727_321134 3300042655 Bacteria 1326
50 Ga0466707_397150 3300042601 Bacteria 1352
51 Ga0466717_262616 3300042604 Bacteria 1092
52 Ga0415639_090552 3300038395 Bacteria 9824
53 Ga0466699_083430 3300042597 Bacteria 1217
54 Ga0466699_156642 3300042597 Bacteria 2502
55 JGI24698J34947_10042089 3300002449 Archaea 2349
56 JGI24698J34947_10086101 3300002449 Bacteria 1457
57 JGI24698J34947_10129209 3300002449 Bacteria 1083
58 JGI24695J34938_10252365 3300002450 Bacteria 749
59 JGI24696J40584_12953833 3300002834 Unclassified 2542
60 Ga0123356_10249391 3300010049 Bacteria 1852
61 Ga0123356_11304523 3300010049 Bacteria 889
62 Ga0123356_11696886 3300010049 Bacteria 784
63 Ga0466712_046765 3300042614 Bacteria 4130
64 Ga0466731_434707 3300042622 Bacteria 1445
65 Ga0562374_0619 3300057007 Bacteria 54809
66 JGI24698J34947_10022343 3300002449 Bacteria 3393
67 JGI24698J34947_10033626 3300002449 Unclassified 2688
68 JGI24698J34947_10065283 3300002449 Unclassified 1775
69 JGI24698J34947_10084442 3300002449 Bacteria 1478
70 JGI24698J34947_10214733 3300002449 Bacteria 743
71 JGI24698J34947_10348217 3300002449 Unclassified 519
72 JGI24702J35022_10417556 3300002462 Bacteria 813
73 Ga0123355_11540100 3300009826 Bacteria 645
74 Ga0123356_11099211 3300010049 Bacteria 963
75 Ga0123356_12318145 3300010049 Bacteria 671
76 Ga0123356_12716249 3300010049 Bacteria 620
77 Ga0123353_10524866 3300010167 Bacteria 1717
78 Ga0123353_10695668 3300010167 Bacteria 1428
79 Ga0123353_12699892 3300010167 Bacteria 585
80 Ga0466699_128706 3300042597 Bacteria 1071
81 Ga0466699_288680 3300042597 Bacteria 2265
82 JGI24698J34947_10017196 3300002449 Bacteria 3921
83 JGI24698J34947_10036682 3300002449 Unclassified 2551
84 JGI24695J34938_10351390 3300002450 Bacteria 648
85 Ga0072940_1100812 3300005200 Bacteria 1774
86 Ga0072941_1005274 3300005201 Bacteria 10815
87 Ga0123355_11760953 3300009826 Bacteria 587
88 Ga0123356_10005661 3300010049 Bacteria 12690
89 Ga0123356_10010534 3300010049 Bacteria 9067
90 Ga0123356_10070821 3300010049 Bacteria 3272
91 Ga0123353_10278712 3300010167 Bacteria 2570
92 Ga0123353_10910590 3300010167 Bacteria 1196
93 Ga0123353_12885984 3300010167 Bacteria 560
94 Ga0466712_018887 3300042614 Bacteria 4515
95 Ga0466712_054379 3300042614 Bacteria 13274
96 Ga0466712_153204 3300042614 Bacteria 14816
97 Ga0466717_312528 3300042604 Bacteria 1676
98 Ga0466657_195902 3300042582 Bacteria 1083
99 Ga0466699_052562 3300042597 Bacteria 9226
100 Ga0466733_004379 3300042659 Bacteria 14206
101 AmiMGMT1_c411674 2228664018 Bacteria 640
102 JGI24698J34947_10104124 3300002449 Bacteria 1268
103 JGI24695J34938_10315136 3300002450 Bacteria 679
104 JGI24702J35022_10013093 3300002462 Bacteria 4602
105 JGI24697J35500_11259353 3300002507 Archaea 2912
106 JGI24699J35502_11003569 3300002509 Bacteria 1364
107 Ga0072941_1205050 3300005201 Bacteria 1355
108 Ga0123357_10576389 3300009784 Bacteria 880
109 Ga0123356_10080078 3300010049 Bacteria 3087
110 Ga0123356_13072996 3300010049 Bacteria 582
111 Ga0123353_11062966 3300010167 Bacteria 1079
112 Ga0466729_132633 3300042621 Bacteria 1501
113 Ga0466731_305389 3300042622 Bacteria 2129
114 Ga0466731_306621 3300042622 Bacteria 1203
115 Ga0466702_170746 3300042635 Bacteria 1905
116 Ga0466707_101548 3300042601 Bacteria 1450
117 Ga0466707_164223 3300042601 Bacteria 1577
118 Ga0466721_107096 3300042608 Bacteria 1000
119 Ga0466699_071625 3300042597 Bacteria 2650
120 Ga0466699_096610 3300042597 Bacteria 1111
121 JGI24698J34947_10029191 3300002449 Bacteria 2915
122 JGI24698J34947_10133583 3300002449 Bacteria 1056
123 JGI24698J34947_10309842 3300002449 Unclassified 566
124 Ga0072941_1000590 3300005201 Bacteria 10434
125 Ga0123357_10234926 3300009784 Bacteria 1999
126 Ga0123357_10271516 3300009784 Bacteria 1771
127 Ga0123356_12128452 3300010049 Bacteria 701
128 Ga0123353_10896687 3300010167 Bacteria 1208
129 Ga0123353_11513621 3300010167 Bacteria 854
130 Ga0466717_297887 3300042604 Bacteria 1508

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2228664018 AmiMGMT1_c411674 AmiMGMT1_4116742 108
2 3300042620 Ga0466728_470408 Ga0466728_470408_248_577 109
3 3300057007 Ga0562374_0619 Ga0562374_0619_37132_37461 109
4 3300010049 Ga0123356_12420320 Ga0123356_124203201 111
5 3300010049 Ga0123356_13123972 Ga0123356_131239721 112
6 3300042597 Ga0466699_052562 Ga0466699_052562_3346_3684 112
7 3300042597 Ga0466699_071625 Ga0466699_071625_873_1211 112
8 3300042597 Ga0466699_083430 Ga0466699_083430_353_691 112
9 3300042597 Ga0466699_126698 Ga0466699_126698_2486_2824 112
10 3300042597 Ga0466699_128706 Ga0466699_128706_560_898 112
11 3300042597 Ga0466699_288680 Ga0466699_288680_151_489 112
12 3300042597 Ga0466699_331554 Ga0466699_331554_768_1106 112
13 3300042602 Ga0466713_056291 Ga0466713_056291_409_747 112
14 3300042604 Ga0466717_221571 Ga0466717_221571_1194_1532 112
15 3300009784 Ga0123357_10271516 Ga0123357_102715162 113
16 3300010049 Ga0123356_10032741 Ga0123356_100327415 113
17 3300010049 Ga0123356_10070821 Ga0123356_100708212 113
18 3300010049 Ga0123356_10080078 Ga0123356_100800785 113
19 3300010049 Ga0123356_11304523 Ga0123356_113045232 113
20 3300010049 Ga0123356_12318145 Ga0123356_123181451 113
21 3300010049 Ga0123356_13036684 Ga0123356_130366842 113
22 3300010167 Ga0123353_10144554 Ga0123353_101445544 113
23 3300010167 Ga0123353_10896687 Ga0123353_108966873 113
24 3300010167 Ga0123353_12885984 Ga0123353_128859841 113
25 3300042597 Ga0466699_096610 Ga0466699_096610_479_820 113
26 3300042597 Ga0466699_156642 Ga0466699_156642_686_1027 113
27 3300042604 Ga0466717_262616 Ga0466717_262616_228_569 113
28 3300042608 Ga0466721_107096 Ga0466721_107096_94_435 113
29 3300042655 Ga0466727_321134 Ga0466727_321134_103_444 113
30 iso_pr_bacteria 2781125696 2781441120 113
31 3300002449 JGI24698J34947_10017714 JGI24698J34947_100177143 114
32 3300002449 JGI24698J34947_10258572 JGI24698J34947_102585722 114
33 3300002450 JGI24695J34938_10011355 JGI24695J34938_100113554 114
34 3300002450 JGI24695J34938_10315136 JGI24695J34938_103151362 114
35 3300002462 JGI24702J35022_10013093 JGI24702J35022_100130933 114
36 3300005201 Ga0072941_1450353 Ga0072941_14503532 114
37 3300009784 Ga0123357_10234926 Ga0123357_102349263 114
38 3300009784 Ga0123357_10576389 Ga0123357_105763892 114
39 3300010049 Ga0123356_10050704 Ga0123356_100507042 114
40 3300010049 Ga0123356_10198041 Ga0123356_101980412 114
41 3300010049 Ga0123356_11696886 Ga0123356_116968862 114
42 3300010167 Ga0123353_10278712 Ga0123353_102787122 114
43 3300010167 Ga0123353_10524866 Ga0123353_105248664 114
44 3300010167 Ga0123353_10695668 Ga0123353_106956682 114
45 3300010167 Ga0123353_11147473 Ga0123353_111474732 114
46 3300010882 Ga0123354_10882175 Ga0123354_108821752 114
47 3300038395 Ga0415639_090552 Ga0415639_090552_8588_8932 114
48 3300038395 Ga0415639_094203 Ga0415639_094203_292_636 114
49 3300038395 Ga0415639_105717 Ga0415639_105717_83_427 114
50 3300042582 Ga0466657_195902 Ga0466657_195902_431_775 114
51 3300042614 Ga0466712_128645 Ga0466712_128645_1409_1753 114
52 3300042614 Ga0466712_246425 Ga0466712_246425_8339_8683 114
53 3300042635 Ga0466702_170746 Ga0466702_170746_1385_1729 114
54 iso_pr_bacteria 2781125649 2781307679 114
55 iso_pr_bacteria 2781125657 2781324368 114
56 3300002449 JGI24698J34947_10006420 JGI24698J34947_100064204 115
57 3300002449 JGI24698J34947_10017196 JGI24698J34947_100171961 115
58 3300002449 JGI24698J34947_10018096 JGI24698J34947_100180963 115
59 3300002449 JGI24698J34947_10029925 JGI24698J34947_100299254 115
60 3300002449 JGI24698J34947_10033626 JGI24698J34947_100336263 115
61 3300002449 JGI24698J34947_10036682 JGI24698J34947_100366822 115
62 3300002449 JGI24698J34947_10071583 JGI24698J34947_100715831 115
63 3300002449 JGI24698J34947_10087842 JGI24698J34947_100878423 115
64 3300002449 JGI24698J34947_10121855 JGI24698J34947_101218552 115
65 3300002449 JGI24698J34947_10309842 JGI24698J34947_103098422 115
66 3300002450 JGI24695J34938_10009751 JGI24695J34938_100097514 115
67 3300002450 JGI24695J34938_10015396 JGI24695J34938_100153963 115
68 3300002450 JGI24695J34938_10160154 JGI24695J34938_101601541 115
69 3300002450 JGI24695J34938_10351390 JGI24695J34938_103513901 115
70 3300002509 JGI24699J35502_11003569 JGI24699J35502_110035691 115
71 3300002834 JGI24696J40584_12953833 JGI24696J40584_129538336 115
72 3300005200 Ga0072940_1100812 Ga0072940_11008124 115
73 3300009826 Ga0123355_10819501 Ga0123355_108195012 115
74 3300009826 Ga0123355_11540100 Ga0123355_115401001 115
75 3300009826 Ga0123355_11760953 Ga0123355_117609531 115
76 3300010049 Ga0123356_10005661 Ga0123356_100056614 115
77 3300010049 Ga0123356_12128452 Ga0123356_121284522 115
78 3300010167 Ga0123353_11062966 Ga0123353_110629662 115
79 3300010167 Ga0123353_11513621 Ga0123353_115136212 115
80 3300010167 Ga0123353_12699892 Ga0123353_126998921 115
81 3300042614 Ga0466712_018887 Ga0466712_018887_808_1155 115
82 3300042614 Ga0466712_024607 Ga0466712_024607_1299_1646 115
83 3300042614 Ga0466712_046765 Ga0466712_046765_3260_3607 115
84 3300042614 Ga0466712_054379 Ga0466712_054379_10524_10871 115
85 3300042614 Ga0466712_153204 Ga0466712_153204_12944_13291 115
86 3300042635 Ga0466702_184620 Ga0466702_184620_612_959 115
87 3300042659 Ga0466733_004379 Ga0466733_004379_713_1060 115
88 3300002449 JGI24698J34947_10015661 JGI24698J34947_100156613 116
89 3300002449 JGI24698J34947_10022343 JGI24698J34947_100223433 116
90 3300002449 JGI24698J34947_10029191 JGI24698J34947_100291912 116
91 3300002449 JGI24698J34947_10042089 JGI24698J34947_100420892 116
92 3300002449 JGI24698J34947_10065283 JGI24698J34947_100652835 116
93 3300002449 JGI24698J34947_10104124 JGI24698J34947_101041241 116
94 3300002449 JGI24698J34947_10129209 JGI24698J34947_101292092 116
95 3300002449 JGI24698J34947_10133583 JGI24698J34947_101335832 116
96 3300002449 JGI24698J34947_10214733 JGI24698J34947_102147332 116
97 3300002449 JGI24698J34947_10348217 JGI24698J34947_103482171 116
98 3300002449 JGI24698J34947_10349480 JGI24698J34947_103494801 116
99 3300002450 JGI24695J34938_10142549 JGI24695J34938_101425492 116
100 3300002450 JGI24695J34938_10252365 JGI24695J34938_102523652 116
101 3300002462 JGI24702J35022_10417556 JGI24702J35022_104175562 116
102 3300002507 JGI24697J35500_11259353 JGI24697J35500_112593535 116
103 3300002834 JGI24696J40584_12958210 JGI24696J40584_129582104 116
104 3300005201 Ga0072941_1000590 Ga0072941_100059012 116
105 3300005201 Ga0072941_1003248 Ga0072941_10032482 116
106 3300005201 Ga0072941_1205050 Ga0072941_12050503 116
107 3300010049 Ga0123356_11099211 Ga0123356_110992111 116
108 3300010049 Ga0123356_12029865 Ga0123356_120298651 116
109 3300010049 Ga0123356_12716249 Ga0123356_127162491 116
110 3300010167 Ga0123353_10003566 Ga0123353_1000356616 116
111 3300042622 Ga0466731_434707 Ga0466731_434707_436_786 116
112 3300042635 Ga0466702_353297 Ga0466702_353297_442_792 116
113 iso_pr_bacteria 2781125661 2781334568 116
114 3300010049 Ga0123356_10010534 Ga0123356_100105348 117
115 3300010049 Ga0123356_13072996 Ga0123356_130729961 117
116 3300010167 Ga0123353_10910590 Ga0123353_109105903 117
117 3300042621 Ga0466729_132633 Ga0466729_132633_91_444 117
118 3300010049 Ga0123356_10249391 Ga0123356_102493912 118
119 3300042601 Ga0466707_101548 Ga0466707_101548_694_1050 118
120 3300042622 Ga0466731_305389 Ga0466731_305389_1093_1449 118
121 3300009826 Ga0123355_10453195 Ga0123355_104531952 119
122 3300042622 Ga0466731_306621 Ga0466731_306621_146_505 119
123 iso_pr_bacteria 2781125694 2781436810 119
124 3300005201 Ga0072941_1005274 Ga0072941_100527413 121
125 3300010049 Ga0123356_10847784 Ga0123356_108477841 121
126 3300010049 Ga0123356_11781555 Ga0123356_117815552 121
127 3300042601 Ga0466707_397150 Ga0466707_397150_538_903 121
128 3300042619 Ga0466726_131561 Ga0466726_131561_3287_3661 124
129 3300010049 Ga0123356_11445119 Ga0123356_114451192 125
130 3300042604 Ga0466717_297887 Ga0466717_297887_369_752 127
131 3300002449 JGI24698J34947_10086101 JGI24698J34947_100861012 128
132 3300002449 JGI24698J34947_10265340 JGI24698J34947_102653401 129
133 3300042604 Ga0466717_312528 Ga0466717_312528_428_820 130
134 3300042601 Ga0466707_164223 Ga0466707_164223_333_728 131
135 3300002449 JGI24698J34947_10084442 JGI24698J34947_100844422 132

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system 8 122 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02452 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.