Protein Family IF05854
Metagenome
Isolate
139
Members
40
Samples
131
Scaffolds
203.88
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_152553|Ga0466707_152553_688_1407
- Length
- 239 aa
- Sequence
- MICVHVEAAKSIKNAVACRNKLNCFRFLRFQKNKRISMALKISATDSDAYKKTAKIIKNGGIAIVPTETVYGFAVDAFNIKAQETVYEIKGRSHRKPLILMTPDIESVKILVDVEQKPLDIAKRFWPGQLTLIFPTTKIGKIVSGGRKDLGVRIPDSKFMMGLLKEIDGPIFTTSVNVSNKQSAKNVDETLNFDGVVDIIVDGGQCEFSFESTVIDMAQFPYVIVRKGCLDTNKLLEYI
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.5%
Unclassified
27.5%
Termitidae
17.5%
Termopsidae
10.0%
Rhinotermitidae
7.5%
Passalidae
2.5%
Hodotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 7 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 8 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 30 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 38 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_321631 | 3300042612 | Bacteria | 270475 |
| 2 | Ga0466706_074985 | 3300042599 | Bacteria | 164025 |
| 3 | Ga0466706_225632 | 3300042599 | Bacteria | 47845 |
| 4 | Ga0466692_024998 | 3300042591 | Bacteria | 5542 |
| 5 | Ga0123357_10063715 | 3300009784 | Bacteria | 4929 |
| 6 | Ga0123355_10018792 | 3300009826 | Bacteria | 10985 |
| 7 | Ga0123355_10102782 | 3300009826 | Bacteria | 4493 |
| 8 | Ga0123356_11705797 | 3300010049 | Bacteria | 782 |
| 9 | Ga0123354_10003487 | 3300010882 | Bacteria | 21735 |
| 10 | Ga0466711_140924 | 3300042615 | Bacteria | 1149 |
| 11 | Ga0466715_087441 | 3300042616 | Unclassified | 23480 |
| 12 | Ga0466715_163831 | 3300042616 | Bacteria | 66780 |
| 13 | Ga0466715_241430 | 3300042616 | Bacteria | 3329 |
| 14 | Ga0466723_066100 | 3300042618 | Bacteria | 4979 |
| 15 | Ga0466728_043696 | 3300042620 | Bacteria | 49439 |
| 16 | Ga0466735_126111 | 3300042624 | Bacteria | 1820 |
| 17 | Ga0466735_167396 | 3300042624 | Bacteria | 14232 |
| 18 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 19 | Ga0466704_287526 | 3300042643 | Bacteria | 40864 |
| 20 | Ga0466704_513006 | 3300042643 | Unclassified | 2904 |
| 21 | Ga0466706_273276 | 3300042599 | Bacteria | 3887 |
| 22 | Ga0466707_027468 | 3300042601 | Bacteria | 23177 |
| 23 | Ga0466707_152553 | 3300042601 | Bacteria | 3238 |
| 24 | Ga0466719_251756 | 3300042606 | Bacteria | 32914 |
| 25 | Ga0466690_162907 | 3300042590 | Unclassified | 6795 |
| 26 | Ga0123356_11095076 | 3300010049 | Bacteria | 965 |
| 27 | Ga0466705_425912 | 3300042612 | Bacteria | 16090 |
| 28 | Ga0466711_288913 | 3300042615 | Unclassified | 1550 |
| 29 | Ga0466723_174309 | 3300042618 | Bacteria | 23145 |
| 30 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 31 | Ga0466735_013073 | 3300042624 | Bacteria | 5252 |
| 32 | Ga0466735_084085 | 3300042624 | Bacteria | 6884 |
| 33 | Ga0466735_096203 | 3300042624 | Bacteria | 2416 |
| 34 | Ga0466704_187080 | 3300042643 | Bacteria | 34147 |
| 35 | Ga0466704_201721 | 3300042643 | Bacteria | 2312 |
| 36 | Ga0466727_084148 | 3300042655 | Bacteria | 121095 |
| 37 | Ga0466705_103431 | 3300042612 | Bacteria | 24857 |
| 38 | Ga0466706_279218 | 3300042599 | Bacteria | 1406 |
| 39 | Ga0466713_080455 | 3300042602 | Bacteria | 8357 |
| 40 | Ga0466714_088412 | 3300042603 | Bacteria | 38937 |
| 41 | Ga0466719_127211 | 3300042606 | Bacteria | 279481 |
| 42 | Ga0466690_270326 | 3300042590 | Bacteria | 4559 |
| 43 | Ga0466691_225685 | 3300042593 | Bacteria | 109994 |
| 44 | 2227222789 | 2225789004 | Bacteria | 1384 |
| 45 | Ga0466715_059237 | 3300042616 | Bacteria | 14895 |
| 46 | Ga0466715_096530 | 3300042616 | Bacteria | 28613 |
| 47 | Ga0466723_025342 | 3300042618 | Unclassified | 25553 |
| 48 | Ga0466726_066696 | 3300042619 | Bacteria | 2896 |
| 49 | Ga0466728_138943 | 3300042620 | Bacteria | 7488 |
| 50 | Ga0466728_312141 | 3300042620 | Bacteria | 13913 |
| 51 | Ga0466729_063577 | 3300042621 | Bacteria | 14850 |
| 52 | Ga0466727_151432 | 3300042655 | Bacteria | 242508 |
| 53 | Ga0466713_064212 | 3300042602 | Bacteria | 10849 |
| 54 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 55 | Ga0466722_137344 | 3300042609 | Bacteria | 1991 |
| 56 | Ga0466692_113515 | 3300042591 | Bacteria | 2290 |
| 57 | Ga0466696_019327 | 3300042596 | Bacteria | 20641 |
| 58 | Ga0123357_10007777 | 3300009784 | Bacteria | 13310 |
| 59 | Ga0466711_200800 | 3300042615 | Bacteria | 96997 |
| 60 | Ga0466726_047803 | 3300042619 | Bacteria | 9116 |
| 61 | Ga0466726_083102 | 3300042619 | Bacteria | 1660 |
| 62 | Ga0466726_189516 | 3300042619 | Bacteria | 8444 |
| 63 | Ga0466735_009488 | 3300042624 | Bacteria | 3685 |
| 64 | Ga0466735_015440 | 3300042624 | Bacteria | 2675 |
| 65 | Ga0466735_018322 | 3300042624 | Bacteria | 7721 |
| 66 | Ga0466735_022771 | 3300042624 | Bacteria | 1987 |
| 67 | Ga0466735_157827 | 3300042624 | Bacteria | 3416 |
| 68 | Ga0466735_183313 | 3300042624 | Bacteria | 5016 |
| 69 | Ga0466735_204501 | 3300042624 | Bacteria | 8132 |
| 70 | Ga0466727_071121 | 3300042655 | Bacteria | 6567 |
| 71 | Ga0466706_203150 | 3300042599 | Bacteria | 155769 |
| 72 | Ga0466707_104531 | 3300042601 | Bacteria | 19839 |
| 73 | Ga0466713_051451 | 3300042602 | Bacteria | 53134 |
| 74 | Ga0466716_236658 | 3300042605 | Bacteria | 11965 |
| 75 | Ga0466719_061845 | 3300042606 | Bacteria | 7951 |
| 76 | Ga0466719_499990 | 3300042606 | Bacteria | 2278 |
| 77 | Ga0466690_124780 | 3300042590 | Bacteria | 8557 |
| 78 | Ga0068305_10001537 | 3300005083 | Bacteria | 36494 |
| 79 | Ga0466711_033141 | 3300042615 | Bacteria | 15742 |
| 80 | Ga0466715_240730 | 3300042616 | Bacteria | 70518 |
| 81 | Ga0466715_627388 | 3300042616 | Bacteria | 115089 |
| 82 | Ga0466723_178916 | 3300042618 | Bacteria | 2883 |
| 83 | Ga0466726_066921 | 3300042619 | Bacteria | 2768 |
| 84 | Ga0466726_391972 | 3300042619 | Bacteria | 33313 |
| 85 | Ga0466735_108042 | 3300042624 | Bacteria | 16362 |
| 86 | Ga0466703_233417 | 3300042636 | Unclassified | 32205 |
| 87 | Ga0466708_159044 | 3300042652 | Bacteria | 2877 |
| 88 | Ga0466707_209791 | 3300042601 | Unclassified | 4979 |
| 89 | Ga0466716_170039 | 3300042605 | Bacteria | 23884 |
| 90 | Ga0466690_128266 | 3300042590 | Bacteria | 31824 |
| 91 | Ga0466690_166408 | 3300042590 | Bacteria | 5868 |
| 92 | Ga0466690_323572 | 3300042590 | Unclassified | 2377 |
| 93 | JGI24702J35022_10000634 | 3300002462 | Bacteria | 21392 |
| 94 | Ga0068305_10000176 | 3300005083 | Bacteria | 51323 |
| 95 | Ga0068305_10012737 | 3300005083 | Bacteria | 6622 |
| 96 | Ga0466711_258288 | 3300042615 | Bacteria | 35671 |
| 97 | Ga0466723_022972 | 3300042618 | Bacteria | 101765 |
| 98 | Ga0466704_093767 | 3300042643 | Bacteria | 61889 |
| 99 | Ga0466704_100241 | 3300042643 | Unclassified | 2907 |
| 100 | Ga0466704_325487 | 3300042643 | Bacteria | 5435 |
| 101 | Ga0466704_484569 | 3300042643 | Bacteria | 8087 |
| 102 | Ga0466707_212729 | 3300042601 | Bacteria | 2481 |
| 103 | Ga0466690_001634 | 3300042590 | Bacteria | 10450 |
| 104 | Ga0466690_050937 | 3300042590 | Bacteria | 25090 |
| 105 | Ga0466690_407111 | 3300042590 | Bacteria | 8861 |
| 106 | Ga0068302_10002579 | 3300005071 | Bacteria | 3737 |
| 107 | Ga0466711_380804 | 3300042615 | Bacteria | 12110 |
| 108 | Ga0466715_130565 | 3300042616 | Bacteria | 11294 |
| 109 | Ga0466723_134133 | 3300042618 | Bacteria | 22285 |
| 110 | Ga0466726_365823 | 3300042619 | Bacteria | 1038 |
| 111 | Ga0466704_245817 | 3300042643 | Bacteria | 34435 |
| 112 | Ga0466727_041865 | 3300042655 | Bacteria | 123201 |
| 113 | Ga0466706_075594 | 3300042599 | Bacteria | 269977 |
| 114 | Ga0466707_186188 | 3300042601 | Bacteria | 29049 |
| 115 | Ga0466713_054647 | 3300042602 | Bacteria | 35906 |
| 116 | Ga0466719_399715 | 3300042606 | Unclassified | 7202 |
| 117 | Ga0466696_021217 | 3300042596 | Unclassified | 18765 |
| 118 | JGI24705J35276_12238695 | 3300002504 | Bacteria | 38475 |
| 119 | Ga0068302_10013984 | 3300005071 | Unclassified | 1971 |
| 120 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 121 | Ga0466715_364548 | 3300042616 | Bacteria | 2537 |
| 122 | Ga0466723_243961 | 3300042618 | Bacteria | 2819 |
| 123 | Ga0466726_124472 | 3300042619 | Bacteria | 44985 |
| 124 | Ga0466726_177243 | 3300042619 | Unclassified | 1698 |
| 125 | Ga0466729_038350 | 3300042621 | Bacteria | 15638 |
| 126 | Ga0466729_130600 | 3300042621 | Bacteria | 8863 |
| 127 | Ga0466735_008503 | 3300042624 | Bacteria | 3176 |
| 128 | Ga0466735_053304 | 3300042624 | Bacteria | 10116 |
| 129 | Ga0466703_158285 | 3300042636 | Bacteria | 84792 |
| 130 | Ga0466704_070455 | 3300042643 | Bacteria | 29825 |
| 131 | Ga0466704_392400 | 3300042643 | Bacteria | 3942 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01300 | Sua5_yciO_yrdC | Telomere recombination | 55 | 228 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01300 | GO:0003725 | double-stranded RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.