Protein Family IF05797
Metagenome
Isolate
118
Members
49
Samples
117
Scaffolds
244.25
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_056482|Ga0466707_056482_1734_2618
- Length
- 294 aa
- Sequence
- MRMNEKKMNTLKAYFIEERQAKRKGGLYHKTQVNLAYNSNRIEGSRLTEEQTRYIFETRTIGFKDEEAVPVDDIIETSNHFVAFDHLIDTIDAPLSSDLMKEFHRIVKTGTSDAVKSWFKIGDWKKLPNEVGGLKTTSPQDVEAEISELDDWYNSIGEISLENIVEHHYRFEKIHPFQDGNGRVGRLLMFRECLKNDIVPFIIDDDHKQFYYRGLKGTSKKPADKASPKREKRSLQGVNEHFHARRNAVSGVFRGALKEFASVRGNLMDTCLSAQDIYAAWIDYFYPELSCKKE
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.6%
Kalotermitidae
22.9%
Passalidae
4.2%
Unclassified
4.2%
Termopsidae
2.1%
Rhinotermitidae
2.1%
Taxonomy
Archaea
1
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 34 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_109357 | 3300042659 | Bacteria | 4520 |
| 2 | Ga0264413_138156 | 3300024493 | Bacteria | 1213 |
| 3 | Ga0466696_423047 | 3300042596 | Bacteria | 2397 |
| 4 | Ga0466710_068674 | 3300042613 | Bacteria | 1249 |
| 5 | Ga0466711_271276 | 3300042615 | Bacteria | 11657 |
| 6 | Ga0466707_056482 | 3300042601 | Bacteria | 2783 |
| 7 | Ga0466714_096713 | 3300042603 | Bacteria | 7149 |
| 8 | Ga0466717_073496 | 3300042604 | Bacteria | 3951 |
| 9 | 2227605477 | 2225789004 | Bacteria | 2301 |
| 10 | IMNBL1DRAFT_c0006505 | 3300000062 | Bacteria | 6369 |
| 11 | JGI24702J35022_10041683 | 3300002462 | Bacteria | 2447 |
| 12 | JGI24702J35022_10295290 | 3300002462 | Bacteria | 955 |
| 13 | Ga0123357_10372050 | 3300009784 | Bacteria | 1338 |
| 14 | Ga0123356_10118460 | 3300010049 | Bacteria | 2571 |
| 15 | Ga0123354_10095532 | 3300010882 | Bacteria | 4067 |
| 16 | Ga0466731_158357 | 3300042622 | Bacteria | 3792 |
| 17 | Ga0466704_144721 | 3300042643 | Bacteria | 5767 |
| 18 | Ga0466709_202465 | 3300042648 | Bacteria | 29781 |
| 19 | Ga0466724_15204 | 3300042649 | Bacteria | 4733 |
| 20 | Ga0466725_447831 | 3300042654 | Bacteria | 4671 |
| 21 | Ga0466732_271471 | 3300042656 | Bacteria | 1208 |
| 22 | Ga0466732_401402 | 3300042656 | Bacteria | 6806 |
| 23 | Ga0466657_278548 | 3300042582 | Bacteria | 2472 |
| 24 | Ga0466690_427377 | 3300042590 | Bacteria | 11784 |
| 25 | Ga0466696_171313 | 3300042596 | Bacteria | 12678 |
| 26 | Ga0466696_183500 | 3300042596 | Bacteria | 3766 |
| 27 | Ga0466705_530720 | 3300042612 | Bacteria | 1062 |
| 28 | Ga0466710_070012 | 3300042613 | Bacteria | 4521 |
| 29 | Ga0466718_074446 | 3300042617 | Bacteria | 6838 |
| 30 | Ga0466717_197002 | 3300042604 | Bacteria | 1057 |
| 31 | Ga0466721_144999 | 3300042608 | Bacteria | 2112 |
| 32 | Ga0466722_009915 | 3300042609 | Bacteria | 2349 |
| 33 | JGI24696J40584_12918694 | 3300002834 | Bacteria | 1324 |
| 34 | Ga0123357_10000533 | 3300009784 | Bacteria | 37401 |
| 35 | Ga0123353_10369359 | 3300010167 | Bacteria | 2152 |
| 36 | Ga0466697_118261 | 3300042611 | Bacteria | 2306 |
| 37 | Ga0466734_130224 | 3300042623 | Bacteria | 4296 |
| 38 | Ga0466702_167445 | 3300042635 | Bacteria | 1359 |
| 39 | Ga0466703_006460 | 3300042636 | Bacteria | 1565 |
| 40 | Ga0466703_029227 | 3300042636 | Bacteria | 5466 |
| 41 | Ga0466710_252370 | 3300042613 | Bacteria | 1560 |
| 42 | Ga0466726_145381 | 3300042619 | Bacteria | 2152 |
| 43 | Ga0466714_062153 | 3300042603 | Bacteria | 2212 |
| 44 | Ga0466714_141402 | 3300042603 | Bacteria | 1170 |
| 45 | 2227491305 | 2225789004 | Bacteria | 20466 |
| 46 | JGI24705J35276_12231577 | 3300002504 | Bacteria | 3986 |
| 47 | Ga0123356_10204240 | 3300010049 | Bacteria | 2018 |
| 48 | Ga0123353_10018294 | 3300010167 | Bacteria | 10354 |
| 49 | Ga0123353_10034996 | 3300010167 | Bacteria | 7849 |
| 50 | Ga0466704_101814 | 3300042643 | Bacteria | 1804 |
| 51 | Ga0466725_367642 | 3300042654 | Bacteria | 2503 |
| 52 | Ga0264413_117495 | 3300024493 | Bacteria | 14541 |
| 53 | Ga0415639_165885 | 3300038395 | Bacteria | 1406 |
| 54 | Ga0466690_254566 | 3300042590 | Bacteria | 1443 |
| 55 | Ga0466711_139446 | 3300042615 | Bacteria | 6885 |
| 56 | Ga0466726_005961 | 3300042619 | Bacteria | 1877 |
| 57 | Ga0466728_045596 | 3300042620 | Bacteria | 30767 |
| 58 | Ga0466700_305077 | 3300042600 | Bacteria | 4702 |
| 59 | Ga0466719_116548 | 3300042606 | Bacteria | 4705 |
| 60 | IMNBL1DRAFT_c0004177 | 3300000062 | Bacteria | 8781 |
| 61 | Ga0123356_11142277 | 3300010049 | Bacteria | 946 |
| 62 | Ga0123353_10364270 | 3300010167 | Bacteria | 2171 |
| 63 | Ga0264413_157320 | 3300024493 | Bacteria | 3762 |
| 64 | Ga0466657_024065 | 3300042582 | Bacteria | 1574 |
| 65 | Ga0466694_002914 | 3300042594 | Bacteria | 1499 |
| 66 | Ga0466694_406260 | 3300042594 | Bacteria | 1045 |
| 67 | Ga0466701_040870 | 3300042598 | Bacteria | 3285 |
| 68 | Ga0466700_290087 | 3300042600 | Bacteria | 1116 |
| 69 | Ga0466716_195666 | 3300042605 | Bacteria | 5997 |
| 70 | Ga0466719_107181 | 3300042606 | Bacteria | 1892 |
| 71 | Ga0466698_394170 | 3300042610 | Bacteria | 1345 |
| 72 | IMNBL1DRAFT_c0053131 | 3300000062 | Archaea | 1264 |
| 73 | JGI24702J35022_10045320 | 3300002462 | Bacteria | 2343 |
| 74 | Ga0072940_1265660 | 3300005200 | Bacteria | 967 |
| 75 | Ga0466703_034794 | 3300042636 | Bacteria | 1207 |
| 76 | Ga0466732_040529 | 3300042656 | Bacteria | 2508 |
| 77 | Ga0466657_265432 | 3300042582 | Bacteria | 4571 |
| 78 | Ga0466693_155022 | 3300042592 | Bacteria | 1174 |
| 79 | Ga0466693_394945 | 3300042592 | Bacteria | 1469 |
| 80 | Ga0466694_170489 | 3300042594 | Bacteria | 1022 |
| 81 | Ga0466723_268357 | 3300042618 | Bacteria | 7801 |
| 82 | Ga0466707_320715 | 3300042601 | Bacteria | 41799 |
| 83 | IMNBL1DRAFT_c0025751 | 3300000062 | Bacteria | 2250 |
| 84 | Ga0123353_10144919 | 3300010167 | Bacteria | 3799 |
| 85 | Ga0123353_11115742 | 3300010167 | Bacteria | 1045 |
| 86 | Ga0466705_103561 | 3300042612 | Bacteria | 7179 |
| 87 | Ga0466703_056377 | 3300042636 | Bacteria | 1944 |
| 88 | Ga0466725_010828 | 3300042654 | Bacteria | 7538 |
| 89 | Ga0466733_009146 | 3300042659 | Bacteria | 3266 |
| 90 | Ga0466656_059033 | 3300042550 | Bacteria | 1629 |
| 91 | Ga0466695_013987 | 3300042595 | Bacteria | 4248 |
| 92 | Ga0466700_277919 | 3300042600 | Bacteria | 1817 |
| 93 | Ga0466717_015395 | 3300042604 | Bacteria | 5194 |
| 94 | Ga0466716_546667 | 3300042605 | Bacteria | 6260 |
| 95 | Ga0466697_049739 | 3300042611 | Bacteria | 2262 |
| 96 | AustNasuHG_c1005030 | 3300000089 | Bacteria | 4730 |
| 97 | Ga0123353_10348814 | 3300010167 | Bacteria | 2231 |
| 98 | Ga0123353_10351949 | 3300010167 | Bacteria | 2219 |
| 99 | Ga0123353_11092773 | 3300010167 | Bacteria | 1060 |
| 100 | Ga0466704_386188 | 3300042643 | Bacteria | 3436 |
| 101 | Ga0466704_608745 | 3300042643 | Bacteria | 1968 |
| 102 | Ga0466725_267380 | 3300042654 | Bacteria | 2177 |
| 103 | Ga0466732_298036 | 3300042656 | Unclassified | 1473 |
| 104 | Ga0466711_229722 | 3300042615 | Bacteria | 14077 |
| 105 | Ga0466726_163456 | 3300042619 | Bacteria | 3495 |
| 106 | Ga0466698_244211 | 3300042610 | Bacteria | 1271 |
| 107 | Ga0466698_392574 | 3300042610 | Bacteria | 1675 |
| 108 | 2227563493 | 2225789004 | Bacteria | 54164 |
| 109 | Ga0123356_10421893 | 3300010049 | Bacteria | 1476 |
| 110 | Ga0123356_10565438 | 3300010049 | Bacteria | 1299 |
| 111 | Ga0123353_10682553 | 3300010167 | Bacteria | 1446 |
| 112 | Ga0123353_11035879 | 3300010167 | Bacteria | 1098 |
| 113 | Ga0466697_165680 | 3300042611 | Bacteria | 2220 |
| 114 | Ga0466705_319407 | 3300042612 | Bacteria | 3602 |
| 115 | Ga0466734_131425 | 3300042623 | Bacteria | 3064 |
| 116 | Ga0466703_001338 | 3300042636 | Bacteria | 1582 |
| 117 | Ga0466704_141776 | 3300042643 | Bacteria | 1488 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02661 | Fic | Fic/DOC family | 94 | 190 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.