Protein Family IF05795
Metagenome
Isolate
256
Members
121
Samples
194
Scaffolds
257.36
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_046475|Ga0466707_046475_4118_5020
- Length
- 300 aa
- Sequence
- MIPRVNIYFFSGQSFSRSPNFSLAARQSVCPLVLFILQLCYNNTMLAKRIIPCLDVHAGRVVKGINFVNIRDVGDPVCCAVEYDQQGADEIVFLDITATFEERRTMADVVRKTAEKVFVPLTVGGGIRTVDDFRAMLRAGADKVAVNSAAVKNPDVIRDAAAIFGSQCVVLAIDAKHSGTSITGDAKYHVYVAGGREDTGIDLVEWAKRGAALGAGEILLTSMDTDGTKAGFDHAMLRAVCEVVDIPVIASGGGGSLSSFADVFLETPADAALAASIFHYGEYTVNDVKAELRRRQIPVR
Sample Types
Isolate
24.2%
Metagenome
75.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
22.7%
Drosophilidae
20.2%
Termitidae
20.2%
Kalotermitidae
10.9%
Elmidae
5.0%
Aleyrodidae
4.2%
Formicidae
4.2%
Culicidae
3.4%
Rhinotermitidae
2.5%
Curculionidae
2.5%
Termopsidae
1.7%
Tenebrionidae
0.8%
Armadillidiidae
0.8%
Passalidae
0.8%
Taxonomy
Archaea
9
Bacteria
229
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2518285589 | Candidatus Portiera aleyrodidarum TV (unscreened) | Isolate | Aleyrodidae |
| 2 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 3 | 2773857690 | Unclassified Methanomassiliicoccaceae Nt197P4bin30 | Isolate | Unclassified |
| 4 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 5 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 6 | 2515154046 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 7 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 8 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 9 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 14 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 15 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 16 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 17 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 2518645538 | Candidatus Portiera aleyrodidarum BT-QVLC | Isolate | Aleyrodidae |
| 26 | 2773857680 | Unclassified Methanomassiliicoccaceae Emb289P3bin41 | Isolate | Unclassified |
| 27 | 2512047025 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 28 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 29 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 30 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 31 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 32 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 33 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 44 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 45 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 46 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 47 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 48 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 49 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 50 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 51 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 52 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 55 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 56 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 57 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 60 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 61 | 2773857685 | Unclassified Methanomassiliicoccaceae Lab288P1bin1 | Isolate | Unclassified |
| 62 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 63 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 64 | 2517093038 | Candidatus Portiera aleyrodidarum BT-B | Isolate | Aleyrodidae |
| 65 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 66 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 67 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 68 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 71 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 72 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 73 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 74 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 75 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 76 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 77 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 78 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 79 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 80 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 81 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 82 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 83 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 84 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 85 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 86 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 87 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 88 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 89 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 90 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 91 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 92 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 93 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 94 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 95 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 96 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 97 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 98 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 99 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 100 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 101 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 102 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 103 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 104 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 105 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 106 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 107 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 108 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 109 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 110 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 111 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 112 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 113 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 114 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 115 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 116 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 117 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 118 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 119 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 120 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 121 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_205194 | 3300042659 | Bacteria | 9389 |
| 2 | Ga0466657_027643 | 3300042582 | Unclassified | 1306 |
| 3 | Ga0466657_067500 | 3300042582 | Unclassified | 1540 |
| 4 | Ga0466657_174782 | 3300042582 | Unclassified | 7424 |
| 5 | Ga0466657_305124 | 3300042582 | Bacteria | 1193 |
| 6 | Ga0466691_089380 | 3300042593 | Bacteria | 13794 |
| 7 | Ga0466691_168163 | 3300042593 | Bacteria | 4501 |
| 8 | Ga0466691_174640 | 3300042593 | Bacteria | 11394 |
| 9 | Ga0466729_223134 | 3300042621 | Bacteria | 15957 |
| 10 | Ga0466703_031276 | 3300042636 | Bacteria | 16523 |
| 11 | Ga0466724_53791 | 3300042649 | Bacteria | 252935 |
| 12 | Ga0466725_154784 | 3300042654 | Bacteria | 63040 |
| 13 | Ga0123355_10241185 | 3300009826 | Bacteria | 2560 |
| 14 | Ga0123356_10084111 | 3300010049 | Bacteria | 3015 |
| 15 | Ga0123353_10154374 | 3300010167 | Bacteria | 3662 |
| 16 | Ga0123353_10166563 | 3300010167 | Bacteria | 3502 |
| 17 | Ga0123353_10385246 | 3300010167 | Bacteria | 2095 |
| 18 | Ga0123353_10540221 | 3300010167 | Bacteria | 1684 |
| 19 | Ga0123353_10841417 | 3300010167 | Bacteria | 1259 |
| 20 | Ga0123353_11080821 | 3300010167 | Bacteria | 1068 |
| 21 | JGI24705J35276_12220409 | 3300002504 | Unclassified | 2266 |
| 22 | Ga0102735_1000069 | 3300007080 | Bacteria | 27159 |
| 23 | Ga0466701_101720 | 3300042598 | Bacteria | 12600 |
| 24 | Ga0466707_012793 | 3300042601 | Bacteria | 6542 |
| 25 | Ga0466707_147482 | 3300042601 | Bacteria | 2075 |
| 26 | Ga0466713_015863 | 3300042602 | Bacteria | 8817 |
| 27 | Ga0466719_185623 | 3300042606 | Bacteria | 1740 |
| 28 | Ga0466711_175496 | 3300042615 | Bacteria | 4338 |
| 29 | Ga0466728_071501 | 3300042620 | Bacteria | 2755 |
| 30 | Ga0466728_435861 | 3300042620 | Bacteria | 1852 |
| 31 | Ga0466705_051795 | 3300042612 | Bacteria | 2596 |
| 32 | Ga0466692_053711 | 3300042591 | Bacteria | 2405 |
| 33 | Ga0466701_013512 | 3300042598 | Archaea | 2000 |
| 34 | Ga0466703_234376 | 3300042636 | Bacteria | 2734 |
| 35 | Ga0123356_10031105 | 3300010049 | Unclassified | 4996 |
| 36 | Ga0123356_10165457 | 3300010049 | Bacteria | 2215 |
| 37 | Ga0123353_10796293 | 3300010167 | Bacteria | 1306 |
| 38 | Ga0123353_10833506 | 3300010167 | Bacteria | 1267 |
| 39 | Ga0123354_10085578 | 3300010882 | Bacteria | 4415 |
| 40 | Ga0123354_10176462 | 3300010882 | Unclassified | 2460 |
| 41 | Ga0466713_134793 | 3300042602 | Unclassified | 2617 |
| 42 | Ga0466719_089205 | 3300042606 | Bacteria | 4675 |
| 43 | Ga0466728_219356 | 3300042620 | Bacteria | 3606 |
| 44 | Ga0466728_427893 | 3300042620 | Bacteria | 3492 |
| 45 | Ga0466705_117168 | 3300042612 | Bacteria | 2793 |
| 46 | Ga0466656_333639 | 3300042550 | Bacteria | 21003 |
| 47 | Ga0466692_203058 | 3300042591 | Bacteria | 50788 |
| 48 | Ga0466734_127878 | 3300042623 | Bacteria | 2990 |
| 49 | Ga0466703_371986 | 3300042636 | Bacteria | 17135 |
| 50 | Ga0466704_089757 | 3300042643 | Bacteria | 31050 |
| 51 | Ga0123357_10031596 | 3300009784 | Bacteria | 7184 |
| 52 | Ga0123356_10000806 | 3300010049 | Bacteria | 34859 |
| 53 | Ga0123356_10002193 | 3300010049 | Bacteria | 21003 |
| 54 | Ga0123356_10010742 | 3300010049 | Bacteria | 8964 |
| 55 | Ga0123353_10003067 | 3300010167 | Bacteria | 20923 |
| 56 | Ga0123353_10083605 | 3300010167 | Bacteria | 5137 |
| 57 | Ga0123353_10511406 | 3300010167 | Bacteria | 1746 |
| 58 | Ga0102739_1013978 | 3300007095 | Bacteria | 1033 |
| 59 | Ga0105553_1099705 | 3300007767 | Bacteria | 4707 |
| 60 | Ga0466707_166552 | 3300042601 | Unclassified | 2171 |
| 61 | Ga0466707_373782 | 3300042601 | Bacteria | 21840 |
| 62 | Ga0466717_263774 | 3300042604 | Bacteria | 3238 |
| 63 | Ga0160470_100873 | 3300012813 | Bacteria | 8944 |
| 64 | Ga0466696_160670 | 3300042596 | Bacteria | 5251 |
| 65 | Ga0466704_077990 | 3300042643 | Unclassified | 6392 |
| 66 | Ga0466704_094615 | 3300042643 | Bacteria | 6505 |
| 67 | Ga0466708_014923 | 3300042652 | Bacteria | 4688 |
| 68 | Ga0466725_061532 | 3300042654 | Bacteria | 12878 |
| 69 | Ga0123355_10868010 | 3300009826 | Bacteria | 988 |
| 70 | Ga0123356_10161731 | 3300010049 | Archaea | 2237 |
| 71 | Ga0123353_10260854 | 3300010167 | Bacteria | 2676 |
| 72 | JGI24702J35022_10013216 | 3300002462 | Bacteria | 4576 |
| 73 | Ga0466701_047531 | 3300042598 | Bacteria | 58092 |
| 74 | Ga0466707_164538 | 3300042601 | Bacteria | 30398 |
| 75 | Ga0466713_062719 | 3300042602 | Bacteria | 59430 |
| 76 | Ga0466713_103246 | 3300042602 | Bacteria | 82594 |
| 77 | Ga0466713_116498 | 3300042602 | Bacteria | 11201 |
| 78 | Ga0466713_132469 | 3300042602 | Bacteria | 12827 |
| 79 | Ga0466717_245371 | 3300042604 | Bacteria | 2582 |
| 80 | Ga0466722_066727 | 3300042609 | Bacteria | 1568 |
| 81 | Ga0466697_071341 | 3300042611 | Bacteria | 1720 |
| 82 | Ga0160472_102618 | 3300012839 | Bacteria | 3963 |
| 83 | Ga0466657_004595 | 3300042582 | Bacteria | 14295 |
| 84 | Ga0466690_384892 | 3300042590 | Bacteria | 29462 |
| 85 | Ga0466696_367695 | 3300042596 | Bacteria | 6269 |
| 86 | Ga0466734_005401 | 3300042623 | Bacteria | 12429 |
| 87 | Ga0123357_10117279 | 3300009784 | Bacteria | 3368 |
| 88 | Ga0123355_10169183 | 3300009826 | Bacteria | 3271 |
| 89 | Ga0123356_10028064 | 3300010049 | Bacteria | 5273 |
| 90 | Ga0123356_10406261 | 3300010049 | Bacteria | 1501 |
| 91 | Ga0123354_10026776 | 3300010882 | Bacteria | 9095 |
| 92 | Ga0123354_10140127 | 3300010882 | Bacteria | 2997 |
| 93 | Ga0160454_103083 | 3300012798 | Bacteria | 1466 |
| 94 | CVPL010W_10013970 | 3300002931 | Bacteria | 5986 |
| 95 | Ga0466707_046475 | 3300042601 | Bacteria | 11693 |
| 96 | Ga0466713_019517 | 3300042602 | Bacteria | 68401 |
| 97 | Ga0466717_015403 | 3300042604 | Bacteria | 1862 |
| 98 | Ga0466719_207559 | 3300042606 | Bacteria | 5238 |
| 99 | Ga0466721_246480 | 3300042608 | Bacteria | 2760 |
| 100 | Ga0466722_184029 | 3300042609 | Bacteria | 3390 |
| 101 | Ga0466722_244924 | 3300042609 | Bacteria | 13242 |
| 102 | Ga0466710_025104 | 3300042613 | Bacteria | 11931 |
| 103 | Ga0466715_225126 | 3300042616 | Bacteria | 17879 |
| 104 | Ga0466715_489248 | 3300042616 | Bacteria | 48521 |
| 105 | Ga0466718_131520 | 3300042617 | Bacteria | 1342 |
| 106 | Ga0466723_289098 | 3300042618 | Bacteria | 4681 |
| 107 | Ga0466726_445129 | 3300042619 | Bacteria | 15103 |
| 108 | Ga0466728_243430 | 3300042620 | Bacteria | 2061 |
| 109 | Ga0466705_147179 | 3300042612 | Bacteria | 9569 |
| 110 | Ga0466705_244897 | 3300042612 | Bacteria | 3409 |
| 111 | Ga0160447_110097 | 3300012849 | Unclassified | 2099 |
| 112 | Ga0160430_103468 | 3300012852 | Bacteria | 4345 |
| 113 | Ga0466657_380949 | 3300042582 | Bacteria | 12696 |
| 114 | Ga0466691_208602 | 3300042593 | Bacteria | 2728 |
| 115 | Ga0466694_391308 | 3300042594 | Bacteria | 1766 |
| 116 | Ga0466696_054188 | 3300042596 | Bacteria | 3087 |
| 117 | Ga0466734_025542 | 3300042623 | Bacteria | 4495 |
| 118 | Ga0466703_133291 | 3300042636 | Bacteria | 1417 |
| 119 | Ga0466703_256586 | 3300042636 | Bacteria | 4965 |
| 120 | Ga0466704_249703 | 3300042643 | Bacteria | 3936 |
| 121 | Ga0466708_131954 | 3300042652 | Bacteria | 12282 |
| 122 | Ga0466725_098385 | 3300042654 | Bacteria | 66425 |
| 123 | Ga0466725_429862 | 3300042654 | Bacteria | 4964 |
| 124 | Ga0123357_10260085 | 3300009784 | Bacteria | 1836 |
| 125 | Ga0123355_10296695 | 3300009826 | Bacteria | 2209 |
| 126 | Ga0123355_10412252 | 3300009826 | Bacteria | 1733 |
| 127 | Ga0123356_10008623 | 3300010049 | Bacteria | 10113 |
| 128 | Ga0123356_10028415 | 3300010049 | Unclassified | 5239 |
| 129 | Ga0123356_10099728 | 3300010049 | Bacteria | 2784 |
| 130 | Ga0123356_10267203 | 3300010049 | Bacteria | 1798 |
| 131 | Ga0123356_10375050 | 3300010049 | Bacteria | 1554 |
| 132 | Ga0123356_10404524 | 3300010049 | Bacteria | 1503 |
| 133 | Ga0123353_10162593 | 3300010167 | Unclassified | 3552 |
| 134 | Ga0123353_10313449 | 3300010167 | Archaea | 2385 |
| 135 | Ga0123353_10450013 | 3300010167 | Bacteria | 1896 |
| 136 | Ga0123353_11100367 | 3300010167 | Unclassified | 1055 |
| 137 | IMNBGM34_c000040 | 3300000036 | Bacteria | 36196 |
| 138 | JGI24705J35276_12233015 | 3300002504 | Bacteria | 4618 |
| 139 | JGI24705J35276_12235763 | 3300002504 | Bacteria | 6953 |
| 140 | Ga0102737_1000120 | 3300007142 | Bacteria | 24954 |
| 141 | Ga0466707_095849 | 3300042601 | Bacteria | 7345 |
| 142 | Ga0466707_296665 | 3300042601 | Bacteria | 1563 |
| 143 | Ga0466707_308968 | 3300042601 | Unclassified | 1803 |
| 144 | Ga0466705_241310 | 3300042612 | Bacteria | 3489 |
| 145 | Ga0160468_100252 | 3300012819 | Bacteria | 28828 |
| 146 | Ga0160436_1011598 | 3300012861 | Unclassified | 1887 |
| 147 | Ga0466692_196296 | 3300042591 | Bacteria | 21527 |
| 148 | Ga0466696_396638 | 3300042596 | Bacteria | 2926 |
| 149 | Ga0466734_094804 | 3300042623 | Bacteria | 13897 |
| 150 | Ga0466730_056293 | 3300042625 | Bacteria | 4765 |
| 151 | Ga0466704_338110 | 3300042643 | Bacteria | 4568 |
| 152 | Ga0466704_364978 | 3300042643 | Bacteria | 3276 |
| 153 | Ga0466727_235346 | 3300042655 | Bacteria | 2101 |
| 154 | Ga0123356_10019878 | 3300010049 | Bacteria | 6363 |
| 155 | Ga0123353_10039943 | 3300010167 | Bacteria | 7396 |
| 156 | Ga0123353_10061120 | 3300010167 | Bacteria | 6041 |
| 157 | Ga0123353_10271145 | 3300010167 | Archaea | 2614 |
| 158 | Ga0123353_10303640 | 3300010167 | Bacteria | 2434 |
| 159 | Ga0123354_10102104 | 3300010882 | Unclassified | 3868 |
| 160 | Ga0160470_100047 | 3300012813 | Bacteria | 181215 |
| 161 | Ga0104019_1008759 | 3300007150 | Bacteria | 1253 |
| 162 | Ga0466701_050834 | 3300042598 | Bacteria | 6288 |
| 163 | Ga0466701_085389 | 3300042598 | Bacteria | 1422 |
| 164 | Ga0466700_153398 | 3300042600 | Bacteria | 1901 |
| 165 | Ga0466707_411930 | 3300042601 | Bacteria | 1631 |
| 166 | Ga0466713_063196 | 3300042602 | Bacteria | 62619 |
| 167 | Ga0466717_251537 | 3300042604 | Bacteria | 2456 |
| 168 | Ga0466722_263687 | 3300042609 | Bacteria | 2406 |
| 169 | Ga0466712_293819 | 3300042614 | Bacteria | 2816 |
| 170 | Ga0466715_004741 | 3300042616 | Bacteria | 2138 |
| 171 | Ga0160472_101011 | 3300012839 | Bacteria | 10087 |
| 172 | Ga0415639_056580 | 3300038395 | Bacteria | 6131 |
| 173 | Ga0466657_191235 | 3300042582 | Bacteria | 1608 |
| 174 | Ga0466657_378630 | 3300042582 | Bacteria | 5037 |
| 175 | Ga0466690_153443 | 3300042590 | Bacteria | 2469 |
| 176 | Ga0466696_260620 | 3300042596 | Bacteria | 2348 |
| 177 | Ga0466701_012228 | 3300042598 | Unclassified | 6132 |
| 178 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 179 | Ga0466704_473269 | 3300042643 | Bacteria | 1698 |
| 180 | Ga0466709_026816 | 3300042648 | Bacteria | 3818 |
| 181 | Ga0466727_166022 | 3300042655 | Bacteria | 7285 |
| 182 | Ga0466727_347967 | 3300042655 | Bacteria | 4191 |
| 183 | Ga0123353_10411633 | 3300010167 | Bacteria | 2007 |
| 184 | Ga0123353_10420986 | 3300010167 | Bacteria | 1979 |
| 185 | Ga0123353_10428141 | 3300010167 | Bacteria | 1958 |
| 186 | Ga0102736_1006933 | 3300007052 | Bacteria | 1373 |
| 187 | Ga0104048_1003578 | 3300007143 | Unclassified | 4499 |
| 188 | Ga0466701_082345 | 3300042598 | Bacteria | 2604 |
| 189 | Ga0466707_197320 | 3300042601 | Bacteria | 7399 |
| 190 | Ga0466707_316820 | 3300042601 | Bacteria | 3454 |
| 191 | Ga0466707_383467 | 3300042601 | Bacteria | 23091 |
| 192 | Ga0466705_518818 | 3300042612 | Bacteria | 1139 |
| 193 | Ga0466715_445301 | 3300042616 | Bacteria | 6398 |
| 194 | Ga0466726_329263 | 3300042619 | Bacteria | 14283 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00977 | His_biosynth | Histidine biosynthesis protein | 49 | 284 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.