Protein Family IF05788
Metagenome
Isolate
184
Members
51
Samples
179
Scaffolds
244.14
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_032313|Ga0466707_032313_2540_3358
- Length
- 272 aa
- Sequence
- LKLLPIPSYRIEQINARQTMKYRLSYKNIMTYLTGFHAIEERIKSGRTCGPLLVAKAGPRARELAALAGEHKIRVDRTGTFDLDRLAPDHRGIALEVEDQTVNVYADITLEDFIAGLNESGKKDALVVILDEITDPHNYGAILRSCDQFGVDLVVSRNRRSAKHAEVVAQTSAGASAWVPSAETANLVRAAEDLKEAGFWIYGADMAGKPVYTLDLRGRVALVLGSEGGGISRLLRERCDSLAAIPSKGKIDSLNVSVAAGVLLYEIIRQRR
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
26.5%
Unclassified
14.3%
Rhinotermitidae
6.1%
Termopsidae
6.1%
Hodotermitidae
2.0%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 42 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_207653 | 3300042612 | Bacteria | 28779 |
| 2 | Ga0072941_1010825 | 3300005201 | Bacteria | 7647 |
| 3 | Ga0074263_103202 | 3300005485 | Unclassified | 4007 |
| 4 | Ga0466712_005899 | 3300042614 | Bacteria | 24210 |
| 5 | Ga0466712_043753 | 3300042614 | Bacteria | 23887 |
| 6 | Ga0466712_299933 | 3300042614 | Unclassified | 7326 |
| 7 | Ga0466712_320346 | 3300042614 | Bacteria | 17677 |
| 8 | Ga0466711_251744 | 3300042615 | Bacteria | 10254 |
| 9 | Ga0466723_128924 | 3300042618 | Bacteria | 8977 |
| 10 | Ga0466723_182623 | 3300042618 | Bacteria | 3408 |
| 11 | Ga0466726_483926 | 3300042619 | Unclassified | 1772 |
| 12 | Ga0466729_049189 | 3300042621 | Bacteria | 1010 |
| 13 | Ga0123357_10559414 | 3300009784 | Unclassified | 906 |
| 14 | Ga0123356_10076460 | 3300010049 | Bacteria | 3155 |
| 15 | Ga0123353_10649702 | 3300010167 | Bacteria | 1493 |
| 16 | Ga0466702_441311 | 3300042635 | Bacteria | 2473 |
| 17 | Ga0466709_018734 | 3300042648 | Bacteria | 2968 |
| 18 | Ga0466724_17728 | 3300042649 | Bacteria | 1095 |
| 19 | Ga0466690_161273 | 3300042590 | Unclassified | 4589 |
| 20 | Ga0466699_320381 | 3300042597 | Bacteria | 3724 |
| 21 | Ga0466707_312557 | 3300042601 | Unclassified | 1965 |
| 22 | Ga0466719_085904 | 3300042606 | Bacteria | 11441 |
| 23 | Ga0466719_337522 | 3300042606 | Bacteria | 2011 |
| 24 | Ga0466719_378767 | 3300042606 | Bacteria | 9294 |
| 25 | Ga0466722_231897 | 3300042609 | Bacteria | 1520 |
| 26 | JGI24698J34947_10078735 | 3300002449 | Unclassified | 1554 |
| 27 | JGI24695J34938_10148012 | 3300002450 | Bacteria | 961 |
| 28 | Ga0068305_10296357 | 3300005083 | Bacteria | 5262 |
| 29 | Ga0072941_1000748 | 3300005201 | Bacteria | 1719 |
| 30 | Ga0466712_045049 | 3300042614 | Bacteria | 38257 |
| 31 | Ga0466712_059080 | 3300042614 | Bacteria | 44737 |
| 32 | Ga0466711_166222 | 3300042615 | Bacteria | 2947 |
| 33 | Ga0466715_075201 | 3300042616 | Bacteria | 8786 |
| 34 | Ga0466715_226149 | 3300042616 | Unclassified | 6152 |
| 35 | Ga0466723_157484 | 3300042618 | Bacteria | 1370 |
| 36 | Ga0466726_142832 | 3300042619 | Unclassified | 2810 |
| 37 | Ga0466726_297741 | 3300042619 | Unclassified | 1866 |
| 38 | Ga0123353_10031304 | 3300010167 | Bacteria | 8238 |
| 39 | Ga0466704_028522 | 3300042643 | Bacteria | 14017 |
| 40 | Ga0466704_088745 | 3300042643 | Bacteria | 6585 |
| 41 | Ga0466704_353347 | 3300042643 | Bacteria | 49388 |
| 42 | Ga0466709_002253 | 3300042648 | Bacteria | 4363 |
| 43 | Ga0466709_339943 | 3300042648 | Bacteria | 9954 |
| 44 | Ga0466708_106196 | 3300042652 | Unclassified | 3123 |
| 45 | Ga0466727_239122 | 3300042655 | Bacteria | 3650 |
| 46 | Ga0264413_103090 | 3300024493 | Bacteria | 5439 |
| 47 | Ga0466699_160176 | 3300042597 | Bacteria | 3980 |
| 48 | Ga0466699_165209 | 3300042597 | Bacteria | 74941 |
| 49 | Ga0466716_481344 | 3300042605 | Bacteria | 3337 |
| 50 | Ga0466722_111455 | 3300042609 | Bacteria | 7413 |
| 51 | Ga0466722_135149 | 3300042609 | Bacteria | 1690 |
| 52 | AustNasuHG_c1014110 | 3300000089 | Unclassified | 2726 |
| 53 | JGI24698J34947_10007025 | 3300002449 | Bacteria | 6188 |
| 54 | Ga0466705_474723 | 3300042612 | Bacteria | 5698 |
| 55 | Ga0466712_098058 | 3300042614 | Bacteria | 19790 |
| 56 | Ga0466723_176288 | 3300042618 | Bacteria | 1478 |
| 57 | Ga0466726_341836 | 3300042619 | Bacteria | 1873 |
| 58 | Ga0123356_10002226 | 3300010049 | Bacteria | 20884 |
| 59 | Ga0466704_189214 | 3300042643 | Bacteria | 3274 |
| 60 | Ga0466709_016027 | 3300042648 | Bacteria | 7234 |
| 61 | Ga0466727_047599 | 3300042655 | Unclassified | 1466 |
| 62 | Ga0264413_106099 | 3300024493 | Bacteria | 12277 |
| 63 | Ga0415639_063265 | 3300038395 | Bacteria | 2592 |
| 64 | Ga0466690_119417 | 3300042590 | Bacteria | 7022 |
| 65 | Ga0466692_168918 | 3300042591 | Bacteria | 2033 |
| 66 | Ga0466692_173902 | 3300042591 | Bacteria | 15167 |
| 67 | Ga0466694_027942 | 3300042594 | Bacteria | 1381 |
| 68 | Ga0466696_318692 | 3300042596 | Bacteria | 1505 |
| 69 | Ga0466699_073385 | 3300042597 | Unclassified | 10283 |
| 70 | Ga0466716_432430 | 3300042605 | Bacteria | 8989 |
| 71 | Ga0466712_025166 | 3300042614 | Bacteria | 29267 |
| 72 | Ga0466712_125640 | 3300042614 | Bacteria | 21364 |
| 73 | Ga0466726_288315 | 3300042619 | Bacteria | 8563 |
| 74 | Ga0466735_046106 | 3300042624 | Bacteria | 1455 |
| 75 | Ga0466703_024196 | 3300042636 | Bacteria | 18856 |
| 76 | Ga0466704_264950 | 3300042643 | Bacteria | 2671 |
| 77 | Ga0466709_111892 | 3300042648 | Bacteria | 4371 |
| 78 | Ga0466691_130929 | 3300042593 | Bacteria | 17359 |
| 79 | Ga0466694_011279 | 3300042594 | Bacteria | 2469 |
| 80 | Ga0466694_043737 | 3300042594 | Bacteria | 1800 |
| 81 | Ga0466694_051462 | 3300042594 | Bacteria | 1188 |
| 82 | Ga0466696_210225 | 3300042596 | Bacteria | 27277 |
| 83 | Ga0466696_313072 | 3300042596 | Bacteria | 3654 |
| 84 | Ga0466699_192094 | 3300042597 | Bacteria | 6364 |
| 85 | Ga0466716_384008 | 3300042605 | Bacteria | 2497 |
| 86 | Ga0466719_039732 | 3300042606 | Bacteria | 4839 |
| 87 | Ga0466719_104467 | 3300042606 | Bacteria | 52022 |
| 88 | Ga0466722_219500 | 3300042609 | Bacteria | 3529 |
| 89 | Ga0466705_351933 | 3300042612 | Bacteria | 6408 |
| 90 | JGI24698J34947_10001312 | 3300002449 | Bacteria | 13042 |
| 91 | JGI24698J34947_10007071 | 3300002449 | Bacteria | 6168 |
| 92 | JGI24698J34947_10024573 | 3300002449 | Bacteria | 3217 |
| 93 | JGI24698J34947_10037244 | 3300002449 | Bacteria | 2528 |
| 94 | JGI24702J35022_10069005 | 3300002462 | Bacteria | 1901 |
| 95 | Ga0466712_055611 | 3300042614 | Bacteria | 7189 |
| 96 | Ga0466712_076997 | 3300042614 | Bacteria | 3197 |
| 97 | Ga0466726_065971 | 3300042619 | Bacteria | 7848 |
| 98 | Ga0466702_462257 | 3300042635 | Bacteria | 1301 |
| 99 | Ga0466703_253452 | 3300042636 | Unclassified | 1052 |
| 100 | Ga0466704_160027 | 3300042643 | Bacteria | 29575 |
| 101 | Ga0466708_049807 | 3300042652 | Bacteria | 8431 |
| 102 | Ga0466727_233416 | 3300042655 | Unclassified | 2939 |
| 103 | Ga0466713_045393 | 3300042602 | Unclassified | 1712 |
| 104 | Ga0466717_019313 | 3300042604 | Bacteria | 1902 |
| 105 | Ga0466717_031333 | 3300042604 | Bacteria | 1015 |
| 106 | Ga0466716_070493 | 3300042605 | Bacteria | 8525 |
| 107 | JGI24698J34947_10038263 | 3300002449 | Unclassified | 2488 |
| 108 | JGI24698J34947_10042974 | 3300002449 | Bacteria | 2319 |
| 109 | JGI24698J34947_10046832 | 3300002449 | Unclassified | 2198 |
| 110 | JGI24698J34947_10054841 | 3300002449 | Bacteria | 1988 |
| 111 | JGI24698J34947_10097754 | 3300002449 | Unclassified | 1328 |
| 112 | JGI24695J34938_10000722 | 3300002450 | Bacteria | 31183 |
| 113 | JGI24695J34938_10000803 | 3300002450 | Bacteria | 29159 |
| 114 | Ga0466705_461127 | 3300042612 | Bacteria | 3534 |
| 115 | Ga0466712_140940 | 3300042614 | Unclassified | 2090 |
| 116 | Ga0466712_240703 | 3300042614 | Bacteria | 5670 |
| 117 | Ga0466715_161747 | 3300042616 | Bacteria | 7274 |
| 118 | Ga0466715_413560 | 3300042616 | Bacteria | 1122 |
| 119 | Ga0466726_033498 | 3300042619 | Unclassified | 1009 |
| 120 | Ga0466731_348619 | 3300042622 | Bacteria | 2508 |
| 121 | Ga0466735_137831 | 3300042624 | Unclassified | 1385 |
| 122 | Ga0466703_100596 | 3300042636 | Bacteria | 3688 |
| 123 | Ga0466709_093376 | 3300042648 | Bacteria | 8279 |
| 124 | Ga0466708_441162 | 3300042652 | Bacteria | 3575 |
| 125 | Ga0466727_308852 | 3300042655 | Unclassified | 1667 |
| 126 | Ga0466692_089277 | 3300042591 | Bacteria | 2012 |
| 127 | Ga0466693_084807 | 3300042592 | Bacteria | 2817 |
| 128 | Ga0466720_218932 | 3300042607 | Bacteria | 13318 |
| 129 | Ga0466722_096120 | 3300042609 | Bacteria | 15491 |
| 130 | JGI24698J34947_10021883 | 3300002449 | Unclassified | 3434 |
| 131 | JGI24695J34938_10000137 | 3300002450 | Bacteria | 66242 |
| 132 | JGI24695J34938_10006077 | 3300002450 | Bacteria | 7354 |
| 133 | Ga0466712_041582 | 3300042614 | Bacteria | 13774 |
| 134 | Ga0466715_169507 | 3300042616 | Bacteria | 3204 |
| 135 | Ga0466718_166333 | 3300042617 | Bacteria | 3689 |
| 136 | Ga0466723_051587 | 3300042618 | Bacteria | 6859 |
| 137 | Ga0466726_220783 | 3300042619 | Bacteria | 1736 |
| 138 | Ga0466703_173126 | 3300042636 | Bacteria | 3253 |
| 139 | Ga0466704_127033 | 3300042643 | Bacteria | 3075 |
| 140 | Ga0466708_013165 | 3300042652 | Bacteria | 23003 |
| 141 | Ga0466727_160230 | 3300042655 | Bacteria | 2287 |
| 142 | Ga0466691_051213 | 3300042593 | Bacteria | 13232 |
| 143 | Ga0466694_099706 | 3300042594 | Bacteria | 3390 |
| 144 | Ga0466695_295531 | 3300042595 | Bacteria | 145433 |
| 145 | Ga0466706_059074 | 3300042599 | Bacteria | 1269 |
| 146 | Ga0466700_214976 | 3300042600 | Bacteria | 5242 |
| 147 | Ga0466707_234463 | 3300042601 | Bacteria | 1155 |
| 148 | Ga0466716_518267 | 3300042605 | Unclassified | 1725 |
| 149 | Ga0466720_097960 | 3300042607 | Bacteria | 12067 |
| 150 | Ga0466705_090456 | 3300042612 | Bacteria | 5959 |
| 151 | Ga0466705_333402 | 3300042612 | Bacteria | 1048 |
| 152 | JGI24695J34938_10000035 | 3300002450 | Bacteria | 102136 |
| 153 | Ga0466712_177191 | 3300042614 | Bacteria | 2701 |
| 154 | Ga0466711_114146 | 3300042615 | Bacteria | 4240 |
| 155 | Ga0466711_114763 | 3300042615 | Bacteria | 3604 |
| 156 | Ga0466718_067198 | 3300042617 | Bacteria | 2925 |
| 157 | Ga0466723_333420 | 3300042618 | Bacteria | 4330 |
| 158 | Ga0123356_10222240 | 3300010049 | Bacteria | 1946 |
| 159 | Ga0123353_10007497 | 3300010167 | Bacteria | 14762 |
| 160 | Ga0466703_146211 | 3300042636 | Bacteria | 3038 |
| 161 | Ga0466703_427125 | 3300042636 | Bacteria | 22449 |
| 162 | Ga0466704_004129 | 3300042643 | Bacteria | 41827 |
| 163 | Ga0466704_004758 | 3300042643 | Bacteria | 42132 |
| 164 | Ga0466704_032239 | 3300042643 | Bacteria | 21487 |
| 165 | Ga0466704_049979 | 3300042643 | Bacteria | 20325 |
| 166 | Ga0466704_180564 | 3300042643 | Bacteria | 35870 |
| 167 | Ga0466708_026801 | 3300042652 | Bacteria | 15931 |
| 168 | Ga0466708_104451 | 3300042652 | Bacteria | 2941 |
| 169 | Ga0466708_442024 | 3300042652 | Unclassified | 3579 |
| 170 | Ga0466692_052497 | 3300042591 | Bacteria | 2675 |
| 171 | Ga0466692_080801 | 3300042591 | Bacteria | 13369 |
| 172 | Ga0466692_115244 | 3300042591 | Bacteria | 40575 |
| 173 | Ga0466696_013382 | 3300042596 | Bacteria | 35562 |
| 174 | Ga0466696_054696 | 3300042596 | Bacteria | 1062 |
| 175 | Ga0466699_108455 | 3300042597 | Bacteria | 1202 |
| 176 | Ga0466699_171786 | 3300042597 | Bacteria | 1251 |
| 177 | Ga0466707_032313 | 3300042601 | Bacteria | 8828 |
| 178 | Ga0466720_177622 | 3300042607 | Bacteria | 17093 |
| 179 | Ga0466722_009665 | 3300042609 | Bacteria | 26209 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08032 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.