Protein Family IF05753
Metagenome
Isolate
115
Members
43
Samples
114
Scaffolds
117.6
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_417578|Ga0466700_417578_784_1269
- Length
- 145 aa
- Sequence
- MRDNIARKAVSVRHCRVAENGMFSVVVVMIKFEDKAVYLCCGYTDMRKSINGLMCLVQNDFDLDPFSNAVFVFCNKSRDRLKILEWDTDGFWLYFKRLERGRFRWVEAGEDNKMVLTNEEFSCLIGSAKLEKKLKRNEVFERSIS
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.5%
Kalotermitidae
23.3%
Rhinotermitidae
4.7%
Termopsidae
4.7%
Hodotermitidae
2.3%
Passalidae
2.3%
Unclassified
2.3%
Taxonomy
Archaea
0
Bacteria
100
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 4 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_321063 | 3300042612 | Bacteria | 4099 |
| 2 | Ga0415639_022048 | 3300038395 | Bacteria | 1668 |
| 3 | Ga0415639_076841 | 3300038395 | Unclassified | 4054 |
| 4 | Ga0415639_277671 | 3300038395 | Bacteria | 1790 |
| 5 | Ga0466700_449000 | 3300042600 | Bacteria | 2433 |
| 6 | Ga0466731_312026 | 3300042622 | Bacteria | 4403 |
| 7 | Ga0466735_019812 | 3300042624 | Bacteria | 3731 |
| 8 | Ga0466724_13340 | 3300042649 | Bacteria | 1536 |
| 9 | Ga0123357_10128763 | 3300009784 | Bacteria | 3160 |
| 10 | Ga0123355_11005730 | 3300009826 | Bacteria | 884 |
| 11 | Ga0123353_10197427 | 3300010167 | Bacteria | 3170 |
| 12 | Ga0123354_10135007 | 3300010882 | Bacteria | 3091 |
| 13 | Ga0466711_359352 | 3300042615 | Bacteria | 1016 |
| 14 | 2227475532 | 2225789004 | Bacteria | 889 |
| 15 | Ga0466706_217658 | 3300042599 | Unclassified | 2390 |
| 16 | Ga0466719_363373 | 3300042606 | Bacteria | 2312 |
| 17 | Ga0466722_182186 | 3300042609 | Bacteria | 2982 |
| 18 | Ga0466731_237116 | 3300042622 | Bacteria | 2668 |
| 19 | Ga0466731_354611 | 3300042622 | Bacteria | 2636 |
| 20 | Ga0466704_048242 | 3300042643 | Unclassified | 2603 |
| 21 | Ga0466709_412759 | 3300042648 | Bacteria | 3634 |
| 22 | Ga0123356_10113384 | 3300010049 | Bacteria | 2623 |
| 23 | Ga0123356_10135500 | 3300010049 | Unclassified | 2420 |
| 24 | Ga0123353_10183971 | 3300010167 | Unclassified | 3305 |
| 25 | Ga0123353_10226403 | 3300010167 | Bacteria | 2919 |
| 26 | Ga0123354_10372193 | 3300010882 | Bacteria | 1245 |
| 27 | Ga0466712_030244 | 3300042614 | Bacteria | 2864 |
| 28 | JGI24696J40584_12787990 | 3300002834 | Bacteria | 847 |
| 29 | Ga0466699_309313 | 3300042597 | Bacteria | 1017 |
| 30 | Ga0466700_354382 | 3300042600 | Bacteria | 1864 |
| 31 | Ga0466719_077137 | 3300042606 | Bacteria | 1359 |
| 32 | Ga0466721_160007 | 3300042608 | Bacteria | 1360 |
| 33 | Ga0466698_267586 | 3300042610 | Bacteria | 1149 |
| 34 | Ga0466725_125475 | 3300042654 | Bacteria | 1446 |
| 35 | Ga0123357_10735365 | 3300009784 | Bacteria | 692 |
| 36 | Ga0123356_10567458 | 3300010049 | Bacteria | 1297 |
| 37 | Ga0466715_060459 | 3300042616 | Bacteria | 2224 |
| 38 | Ga0072940_1477173 | 3300005200 | Bacteria | 2090 |
| 39 | Ga0415639_123338 | 3300038395 | Bacteria | 1610 |
| 40 | Ga0466694_048556 | 3300042594 | Bacteria | 2466 |
| 41 | Ga0466694_308213 | 3300042594 | Bacteria | 2659 |
| 42 | Ga0466706_265673 | 3300042599 | Unclassified | 2504 |
| 43 | Ga0466714_094189 | 3300042603 | Bacteria | 4070 |
| 44 | Ga0466721_261983 | 3300042608 | Bacteria | 1131 |
| 45 | Ga0466698_133218 | 3300042610 | Bacteria | 1231 |
| 46 | Ga0466731_051392 | 3300042622 | Bacteria | 2653 |
| 47 | Ga0466702_395887 | 3300042635 | Bacteria | 3496 |
| 48 | Ga0466703_068283 | 3300042636 | Bacteria | 1087 |
| 49 | Ga0466703_076105 | 3300042636 | Unclassified | 2996 |
| 50 | Ga0466704_149406 | 3300042643 | Bacteria | 1078 |
| 51 | Ga0123357_10691164 | 3300009784 | Bacteria | 735 |
| 52 | Ga0123356_10435687 | 3300010049 | Bacteria | 1456 |
| 53 | Ga0123356_12499931 | 3300010049 | Bacteria | 646 |
| 54 | Ga0123353_10536173 | 3300010167 | Bacteria | 1693 |
| 55 | Ga0466718_110388 | 3300042617 | Bacteria | 2859 |
| 56 | Ga0466723_112446 | 3300042618 | Bacteria | 1505 |
| 57 | Ga0466726_483712 | 3300042619 | Bacteria | 2699 |
| 58 | Ga0466696_117522 | 3300042596 | Bacteria | 1468 |
| 59 | Ga0466719_277280 | 3300042606 | Bacteria | 5511 |
| 60 | Ga0466697_026743 | 3300042611 | Bacteria | 1401 |
| 61 | Ga0466734_053372 | 3300042623 | Bacteria | 1168 |
| 62 | Ga0123355_10217326 | 3300009826 | Bacteria | 2756 |
| 63 | Ga0123355_11729792 | 3300009826 | Unclassified | 594 |
| 64 | Ga0123356_10088437 | 3300010049 | Bacteria | 2945 |
| 65 | Ga0123356_10595208 | 3300010049 | Bacteria | 1270 |
| 66 | Ga0123353_10543938 | 3300010167 | Bacteria | 1677 |
| 67 | Ga0123353_11649443 | 3300010167 | Bacteria | 806 |
| 68 | Ga0123353_13210270 | 3300010167 | Bacteria | 524 |
| 69 | Ga0123354_10556433 | 3300010882 | Unclassified | 862 |
| 70 | Ga0466729_024633 | 3300042621 | Bacteria | 2722 |
| 71 | JGI24695J34938_10286949 | 3300002450 | Unclassified | 708 |
| 72 | Ga0466705_013094 | 3300042612 | Bacteria | 3262 |
| 73 | Ga0466705_302084 | 3300042612 | Bacteria | 1997 |
| 74 | Ga0415639_162201 | 3300038395 | Bacteria | 2141 |
| 75 | Ga0466691_032986 | 3300042593 | Bacteria | 2020 |
| 76 | Ga0466721_198465 | 3300042608 | Bacteria | 1124 |
| 77 | Ga0466698_233461 | 3300042610 | Bacteria | 1218 |
| 78 | Ga0466698_440862 | 3300042610 | Bacteria | 1129 |
| 79 | Ga0466731_405606 | 3300042622 | Bacteria | 1207 |
| 80 | Ga0466702_117821 | 3300042635 | Bacteria | 1605 |
| 81 | Ga0466725_418292 | 3300042654 | Bacteria | 2983 |
| 82 | Ga0123357_10607243 | 3300009784 | Bacteria | 836 |
| 83 | Ga0123355_10723475 | 3300009826 | Bacteria | 1135 |
| 84 | Ga0123355_10824900 | 3300009826 | Bacteria | 1027 |
| 85 | Ga0123356_10242457 | 3300010049 | Bacteria | 1874 |
| 86 | Ga0123353_10547940 | 3300010167 | Bacteria | 1669 |
| 87 | Ga0466710_187905 | 3300042613 | Bacteria | 1147 |
| 88 | Ga0466715_222654 | 3300042616 | Bacteria | 1232 |
| 89 | Ga0466693_274425 | 3300042592 | Bacteria | 1389 |
| 90 | Ga0466691_021245 | 3300042593 | Bacteria | 7389 |
| 91 | Ga0466714_023286 | 3300042603 | Bacteria | 4065 |
| 92 | Ga0466731_226436 | 3300042622 | Unclassified | 3362 |
| 93 | Ga0466734_006760 | 3300042623 | Bacteria | 1615 |
| 94 | Ga0466704_487067 | 3300042643 | Bacteria | 1221 |
| 95 | Ga0123356_10102710 | 3300010049 | Bacteria | 2745 |
| 96 | Ga0123354_10301015 | 3300010882 | Bacteria | 1517 |
| 97 | Ga0123354_10488123 | 3300010882 | Bacteria | 969 |
| 98 | Ga0123354_10660313 | 3300010882 | Unclassified | 744 |
| 99 | Ga0466710_134987 | 3300042613 | Bacteria | 1179 |
| 100 | Ga0466710_213133 | 3300042613 | Unclassified | 1343 |
| 101 | Ga0072940_1325291 | 3300005200 | Bacteria | 1061 |
| 102 | Ga0415639_015719 | 3300038395 | Bacteria | 3253 |
| 103 | Ga0415639_103606 | 3300038395 | Bacteria | 2407 |
| 104 | Ga0466693_050644 | 3300042592 | Unclassified | 1548 |
| 105 | Ga0466700_417578 | 3300042600 | Bacteria | 1551 |
| 106 | Ga0466700_426303 | 3300042600 | Bacteria | 1823 |
| 107 | Ga0466717_022294 | 3300042604 | Bacteria | 1281 |
| 108 | Ga0466734_170497 | 3300042623 | Bacteria | 1857 |
| 109 | Ga0466724_59560 | 3300042649 | Bacteria | 2606 |
| 110 | Ga0123357_10289048 | 3300009784 | Bacteria | 1678 |
| 111 | Ga0123355_10309080 | 3300009826 | Bacteria | 2145 |
| 112 | Ga0123355_11784668 | 3300009826 | Unclassified | 581 |
| 113 | Ga0123353_10634237 | 3300010167 | Bacteria | 1517 |
| 114 | Ga0123353_12914858 | 3300010167 | Bacteria | 557 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010882 | Ga0123354_10660313 | Ga0123354_106603132 | 101 |
| 2 | 3300042592 | Ga0466693_050644 | Ga0466693_050644_309_614 | 101 |
| 3 | 3300042599 | Ga0466706_217658 | Ga0466706_217658_622_927 | 101 |
| 4 | 3300042599 | Ga0466706_265673 | Ga0466706_265673_573_878 | 101 |
| 5 | 3300042613 | Ga0466710_213133 | Ga0466710_213133_117_422 | 101 |
| 6 | 3300042622 | Ga0466731_226436 | Ga0466731_226436_730_1035 | 101 |
| 7 | 3300042610 | Ga0466698_233461 | Ga0466698_233461_560_910 | 116 |
| 8 | 3300042617 | Ga0466718_110388 | Ga0466718_110388_553_903 | 116 |
| 9 | 3300042622 | Ga0466731_405606 | Ga0466731_405606_655_1005 | 116 |
| 10 | 2225789004 | 2227475532 | 2227927177 | 117 |
| 11 | 3300005200 | Ga0072940_1325291 | Ga0072940_13252912 | 117 |
| 12 | 3300009826 | Ga0123355_10309080 | Ga0123355_103090802 | 117 |
| 13 | 3300009826 | Ga0123355_10824900 | Ga0123355_108249002 | 117 |
| 14 | 3300009826 | Ga0123355_11729792 | Ga0123355_117297921 | 117 |
| 15 | 3300010167 | Ga0123353_10183971 | Ga0123353_101839712 | 117 |
| 16 | 3300038395 | Ga0415639_022048 | Ga0415639_022048_422_775 | 117 |
| 17 | 3300038395 | Ga0415639_103606 | Ga0415639_103606_505_858 | 117 |
| 18 | 3300038395 | Ga0415639_162201 | Ga0415639_162201_547_900 | 117 |
| 19 | 3300042592 | Ga0466693_274425 | Ga0466693_274425_821_1174 | 117 |
| 20 | 3300042593 | Ga0466691_021245 | Ga0466691_021245_2385_2738 | 117 |
| 21 | 3300042594 | Ga0466694_048556 | Ga0466694_048556_85_438 | 117 |
| 22 | 3300042594 | Ga0466694_308213 | Ga0466694_308213_1735_2088 | 117 |
| 23 | 3300042596 | Ga0466696_117522 | Ga0466696_117522_601_954 | 117 |
| 24 | 3300042597 | Ga0466699_309313 | Ga0466699_309313_285_638 | 117 |
| 25 | 3300042600 | Ga0466700_354382 | Ga0466700_354382_294_647 | 117 |
| 26 | 3300042603 | Ga0466714_023286 | Ga0466714_023286_2152_2505 | 117 |
| 27 | 3300042603 | Ga0466714_094189 | Ga0466714_094189_3153_3506 | 117 |
| 28 | 3300042606 | Ga0466719_077137 | Ga0466719_077137_451_804 | 117 |
| 29 | 3300042606 | Ga0466719_277280 | Ga0466719_277280_2678_3031 | 117 |
| 30 | 3300042606 | Ga0466719_363373 | Ga0466719_363373_1169_1522 | 117 |
| 31 | 3300042608 | Ga0466721_160007 | Ga0466721_160007_576_929 | 117 |
| 32 | 3300042608 | Ga0466721_198465 | Ga0466721_198465_194_547 | 117 |
| 33 | 3300042608 | Ga0466721_261983 | Ga0466721_261983_170_523 | 117 |
| 34 | 3300042609 | Ga0466722_182186 | Ga0466722_182186_505_858 | 117 |
| 35 | 3300042611 | Ga0466697_026743 | Ga0466697_026743_575_928 | 117 |
| 36 | 3300042612 | Ga0466705_013094 | Ga0466705_013094_2299_2652 | 117 |
| 37 | 3300042612 | Ga0466705_302084 | Ga0466705_302084_1338_1691 | 117 |
| 38 | 3300042613 | Ga0466710_134987 | Ga0466710_134987_579_932 | 117 |
| 39 | 3300042615 | Ga0466711_359352 | Ga0466711_359352_306_659 | 117 |
| 40 | 3300042616 | Ga0466715_060459 | Ga0466715_060459_1164_1517 | 117 |
| 41 | 3300042616 | Ga0466715_222654 | Ga0466715_222654_312_665 | 117 |
| 42 | 3300042619 | Ga0466726_483712 | Ga0466726_483712_534_887 | 117 |
| 43 | 3300042621 | Ga0466729_024633 | Ga0466729_024633_1859_2212 | 117 |
| 44 | 3300042622 | Ga0466731_051392 | Ga0466731_051392_524_877 | 117 |
| 45 | 3300042622 | Ga0466731_237116 | Ga0466731_237116_423_776 | 117 |
| 46 | 3300042622 | Ga0466731_312026 | Ga0466731_312026_1688_2041 | 117 |
| 47 | 3300042623 | Ga0466734_006760 | Ga0466734_006760_743_1096 | 117 |
| 48 | 3300042623 | Ga0466734_053372 | Ga0466734_053372_156_509 | 117 |
| 49 | 3300042623 | Ga0466734_170497 | Ga0466734_170497_948_1301 | 117 |
| 50 | 3300042624 | Ga0466735_019812 | Ga0466735_019812_777_1130 | 117 |
| 51 | 3300042635 | Ga0466702_117821 | Ga0466702_117821_576_929 | 117 |
| 52 | 3300042635 | Ga0466702_395887 | Ga0466702_395887_941_1294 | 117 |
| 53 | 3300042636 | Ga0466703_068283 | Ga0466703_068283_212_565 | 117 |
| 54 | 3300042636 | Ga0466703_076105 | Ga0466703_076105_2058_2411 | 117 |
| 55 | 3300042643 | Ga0466704_048242 | Ga0466704_048242_865_1218 | 117 |
| 56 | 3300042643 | Ga0466704_149406 | Ga0466704_149406_302_655 | 117 |
| 57 | 3300042643 | Ga0466704_487067 | Ga0466704_487067_284_637 | 117 |
| 58 | 3300042648 | Ga0466709_412759 | Ga0466709_412759_2092_2445 | 117 |
| 59 | 3300042649 | Ga0466724_13340 | Ga0466724_13340_199_552 | 117 |
| 60 | 3300042649 | Ga0466724_59560 | Ga0466724_59560_585_938 | 117 |
| 61 | 3300042654 | Ga0466725_418292 | Ga0466725_418292_2018_2371 | 117 |
| 62 | iso_pr_bacteria | 2820319488 | 2820320392 | 117 |
| 63 | 3300002450 | JGI24695J34938_10286949 | JGI24695J34938_102869491 | 118 |
| 64 | 3300002834 | JGI24696J40584_12787990 | JGI24696J40584_127879902 | 118 |
| 65 | 3300009784 | Ga0123357_10128763 | Ga0123357_101287633 | 118 |
| 66 | 3300009784 | Ga0123357_10289048 | Ga0123357_102890482 | 118 |
| 67 | 3300009784 | Ga0123357_10691164 | Ga0123357_106911642 | 118 |
| 68 | 3300009784 | Ga0123357_10735365 | Ga0123357_107353652 | 118 |
| 69 | 3300009826 | Ga0123355_11005730 | Ga0123355_110057302 | 118 |
| 70 | 3300010049 | Ga0123356_10135500 | Ga0123356_101355002 | 118 |
| 71 | 3300010049 | Ga0123356_10242457 | Ga0123356_102424572 | 118 |
| 72 | 3300010049 | Ga0123356_10435687 | Ga0123356_104356872 | 118 |
| 73 | 3300010049 | Ga0123356_10567458 | Ga0123356_105674583 | 118 |
| 74 | 3300010049 | Ga0123356_10595208 | Ga0123356_105952081 | 118 |
| 75 | 3300010167 | Ga0123353_10197427 | Ga0123353_101974273 | 118 |
| 76 | 3300010167 | Ga0123353_10226403 | Ga0123353_102264032 | 118 |
| 77 | 3300010167 | Ga0123353_10536173 | Ga0123353_105361732 | 118 |
| 78 | 3300010167 | Ga0123353_10543938 | Ga0123353_105439382 | 118 |
| 79 | 3300010167 | Ga0123353_10547940 | Ga0123353_105479402 | 118 |
| 80 | 3300010167 | Ga0123353_10634237 | Ga0123353_106342373 | 118 |
| 81 | 3300010882 | Ga0123354_10135007 | Ga0123354_101350072 | 118 |
| 82 | 3300010882 | Ga0123354_10301015 | Ga0123354_103010153 | 118 |
| 83 | 3300010882 | Ga0123354_10488123 | Ga0123354_104881232 | 118 |
| 84 | 3300038395 | Ga0415639_277671 | Ga0415639_277671_114_470 | 118 |
| 85 | 3300042600 | Ga0466700_449000 | Ga0466700_449000_637_993 | 118 |
| 86 | 3300042610 | Ga0466698_133218 | Ga0466698_133218_613_969 | 118 |
| 87 | 3300042610 | Ga0466698_267586 | Ga0466698_267586_506_862 | 118 |
| 88 | 3300042610 | Ga0466698_440862 | Ga0466698_440862_198_554 | 118 |
| 89 | 3300042613 | Ga0466710_187905 | Ga0466710_187905_76_432 | 118 |
| 90 | 3300042614 | Ga0466712_030244 | Ga0466712_030244_578_934 | 118 |
| 91 | 3300042618 | Ga0466723_112446 | Ga0466723_112446_262_618 | 118 |
| 92 | 3300042622 | Ga0466731_354611 | Ga0466731_354611_519_875 | 118 |
| 93 | 3300005200 | Ga0072940_1477173 | Ga0072940_14771732 | 119 |
| 94 | 3300009826 | Ga0123355_10217326 | Ga0123355_102173263 | 119 |
| 95 | 3300009826 | Ga0123355_10723475 | Ga0123355_107234752 | 119 |
| 96 | 3300009826 | Ga0123355_11784668 | Ga0123355_117846681 | 119 |
| 97 | 3300010049 | Ga0123356_10088437 | Ga0123356_100884373 | 119 |
| 98 | 3300010049 | Ga0123356_10102710 | Ga0123356_101027103 | 119 |
| 99 | 3300010049 | Ga0123356_10113384 | Ga0123356_101133843 | 119 |
| 100 | 3300010049 | Ga0123356_12499931 | Ga0123356_124999311 | 119 |
| 101 | 3300010167 | Ga0123353_11649443 | Ga0123353_116494432 | 119 |
| 102 | 3300010167 | Ga0123353_12914858 | Ga0123353_129148582 | 119 |
| 103 | 3300010882 | Ga0123354_10372193 | Ga0123354_103721932 | 119 |
| 104 | 3300010882 | Ga0123354_10556433 | Ga0123354_105564332 | 119 |
| 105 | 3300038395 | Ga0415639_076841 | Ga0415639_076841_1572_1931 | 119 |
| 106 | 3300038395 | Ga0415639_123338 | Ga0415639_123338_646_1005 | 119 |
| 107 | 3300042593 | Ga0466691_032986 | Ga0466691_032986_1565_1924 | 119 |
| 108 | 3300038395 | Ga0415639_015719 | Ga0415639_015719_1650_2024 | 124 |
| 109 | 3300042612 | Ga0466705_321063 | Ga0466705_321063_1922_2296 | 124 |
| 110 | 3300009784 | Ga0123357_10607243 | Ga0123357_106072432 | 126 |
| 111 | 3300010167 | Ga0123353_13210270 | Ga0123353_132102701 | 126 |
| 112 | 3300042654 | Ga0466725_125475 | Ga0466725_125475_555_947 | 130 |
| 113 | 3300042600 | Ga0466700_426303 | Ga0466700_426303_524_919 | 131 |
| 114 | 3300042604 | Ga0466717_022294 | Ga0466717_022294_808_1224 | 138 |
| 115 | 3300042600 | Ga0466700_417578 | Ga0466700_417578_784_1269 | 145 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05717 | TnpB_IS66 | IS66 Orf2 like protein | 36 | 132 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.69 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.