Protein Family IF05752
Metagenome
Isolate
128
Members
52
Samples
114
Scaffolds
155.68
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_408667|Ga0466700_408667_1929_2471
- Length
- 180 aa
- Sequence
- MKEEEKEVKALATYYATISDMPETEYKVEILKDGAIKEISVNGTVYEVDYNIGGDTIHSIIMNHKSHGVQITSLGNSNYEVKNKGDYFQVNVVDELQKMRMLRTKSSVIGRQVITAQMPGVILKVYVKPGEEVKAGAPLCVLVAMKMENEIRSPIDGTVKEVYVKDNDKMSVDDKMLVVE
Sample Types
Isolate
10.9%
Metagenome
89.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Blattidae
23.5%
Kalotermitidae
17.6%
Unclassified
7.8%
Termopsidae
7.8%
Hodotermitidae
2.0%
Rhinotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 3 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 4 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 7 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 8 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 9 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 35 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 36 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 37 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 38 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_355591 | 3300042612 | Bacteria | 2034 |
| 2 | Ga0466715_284898 | 3300042616 | Bacteria | 18837 |
| 3 | Ga0466695_327186 | 3300042595 | Bacteria | 1256 |
| 4 | Ga0123354_10000120 | 3300010882 | Bacteria | 58957 |
| 5 | Ga0123354_10008354 | 3300010882 | Bacteria | 15731 |
| 6 | Ga0123354_10027201 | 3300010882 | Bacteria | 9011 |
| 7 | Ga0123354_10243182 | 3300010882 | Bacteria | 1845 |
| 8 | Ga0466731_004207 | 3300042622 | Bacteria | 4606 |
| 9 | Ga0466734_064105 | 3300042623 | Bacteria | 1169 |
| 10 | Ga0466703_078820 | 3300042636 | Bacteria | 9512 |
| 11 | Ga0466704_029228 | 3300042643 | Bacteria | 1471 |
| 12 | Ga0466704_388770 | 3300042643 | Unclassified | 8857 |
| 13 | Ga0466704_410680 | 3300042643 | Bacteria | 13705 |
| 14 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 15 | Ga0466707_256457 | 3300042601 | Bacteria | 2541 |
| 16 | Ga0466722_003963 | 3300042609 | Bacteria | 3969 |
| 17 | JGI24702J35022_10166423 | 3300002462 | Bacteria | 1245 |
| 18 | Ga0466697_185163 | 3300042611 | Bacteria | 2913 |
| 19 | Ga0466705_055038 | 3300042612 | Bacteria | 4430 |
| 20 | Ga0466705_124204 | 3300042612 | Bacteria | 47476 |
| 21 | Ga0466711_096136 | 3300042615 | Bacteria | 5291 |
| 22 | Ga0466726_043965 | 3300042619 | Bacteria | 17028 |
| 23 | Ga0466656_174168 | 3300042550 | Bacteria | 2088 |
| 24 | Ga0466656_217208 | 3300042550 | Bacteria | 1100 |
| 25 | Ga0466696_065573 | 3300042596 | Bacteria | 20563 |
| 26 | Ga0123357_10344842 | 3300009784 | Bacteria | 1434 |
| 27 | Ga0466703_108537 | 3300042636 | Bacteria | 10917 |
| 28 | Ga0466700_274040 | 3300042600 | Bacteria | 4251 |
| 29 | JGI24699J35502_11134041 | 3300002509 | Bacteria | 26254 |
| 30 | Ga0466710_176081 | 3300042613 | Bacteria | 1249 |
| 31 | Ga0466711_220894 | 3300042615 | Bacteria | 1617 |
| 32 | Ga0466711_394852 | 3300042615 | Bacteria | 15895 |
| 33 | Ga0466690_416190 | 3300042590 | Bacteria | 37438 |
| 34 | Ga0123356_13033031 | 3300010049 | Bacteria | 586 |
| 35 | Ga0123354_10320942 | 3300010882 | Unclassified | 1429 |
| 36 | Ga0123354_10449240 | 3300010882 | Unclassified | 1045 |
| 37 | Ga0466735_052071 | 3300042624 | Bacteria | 1016 |
| 38 | Ga0466735_195165 | 3300042624 | Bacteria | 5459 |
| 39 | Ga0466703_023634 | 3300042636 | Bacteria | 12620 |
| 40 | Ga0466704_054584 | 3300042643 | Unclassified | 9419 |
| 41 | Ga0466704_232528 | 3300042643 | Bacteria | 8961 |
| 42 | Ga0466700_408667 | 3300042600 | Bacteria | 3458 |
| 43 | Ga0466719_021650 | 3300042606 | Bacteria | 5841 |
| 44 | JGI24699J35502_11134100 | 3300002509 | Bacteria | 30804 |
| 45 | JGI24696J40584_12901069 | 3300002834 | Bacteria | 1186 |
| 46 | Ga0466697_255579 | 3300042611 | Bacteria | 1202 |
| 47 | Ga0466705_061135 | 3300042612 | Bacteria | 4488 |
| 48 | Ga0466705_210051 | 3300042612 | Bacteria | 6057 |
| 49 | Ga0466715_367634 | 3300042616 | Bacteria | 77620 |
| 50 | Ga0466726_028385 | 3300042619 | Bacteria | 10985 |
| 51 | Ga0123357_10054229 | 3300009784 | Bacteria | 5406 |
| 52 | Ga0123356_10157521 | 3300010049 | Unclassified | 2263 |
| 53 | Ga0123353_10234591 | 3300010167 | Bacteria | 2857 |
| 54 | Ga0123353_11262614 | 3300010167 | Bacteria | 963 |
| 55 | Ga0123354_10028237 | 3300010882 | Bacteria | 8837 |
| 56 | Ga0466704_012326 | 3300042643 | Bacteria | 1455 |
| 57 | Ga0466704_307329 | 3300042643 | Unclassified | 7350 |
| 58 | Ga0466706_171761 | 3300042599 | Bacteria | 6431 |
| 59 | Ga0466719_247489 | 3300042606 | Bacteria | 3411 |
| 60 | Ga0466697_001005 | 3300042611 | Bacteria | 1719 |
| 61 | JGI24702J35022_10027424 | 3300002462 | Bacteria | 3064 |
| 62 | JGI24696J40584_12770340 | 3300002834 | Bacteria | 821 |
| 63 | Ga0068302_10037210 | 3300005071 | Unclassified | 2805 |
| 64 | Ga0466705_039691 | 3300042612 | Unclassified | 2632 |
| 65 | Ga0466711_088839 | 3300042615 | Bacteria | 1433 |
| 66 | Ga0466715_284070 | 3300042616 | Bacteria | 4836 |
| 67 | Ga0466728_081430 | 3300042620 | Bacteria | 4559 |
| 68 | Ga0466656_331238 | 3300042550 | Bacteria | 1663 |
| 69 | Ga0466696_030077 | 3300042596 | Bacteria | 5770 |
| 70 | Ga0123356_10014634 | 3300010049 | Bacteria | 7539 |
| 71 | Ga0123356_10390182 | 3300010049 | Bacteria | 1527 |
| 72 | Ga0123353_10836471 | 3300010167 | Unclassified | 1264 |
| 73 | Ga0466735_075220 | 3300042624 | Bacteria | 2076 |
| 74 | Ga0466703_072985 | 3300042636 | Bacteria | 12798 |
| 75 | Ga0466704_253431 | 3300042643 | Bacteria | 14899 |
| 76 | Ga0466700_013542 | 3300042600 | Bacteria | 1086 |
| 77 | Ga0466710_167585 | 3300042613 | Bacteria | 1503 |
| 78 | Ga0466715_141732 | 3300042616 | Bacteria | 3998 |
| 79 | Ga0466693_021708 | 3300042592 | Bacteria | 1173 |
| 80 | Ga0466694_245623 | 3300042594 | Bacteria | 2847 |
| 81 | Ga0466694_259232 | 3300042594 | Bacteria | 2015 |
| 82 | Ga0123357_10024420 | 3300009784 | Bacteria | 8137 |
| 83 | Ga0123357_10034661 | 3300009784 | Bacteria | 6862 |
| 84 | Ga0123354_10557491 | 3300010882 | Unclassified | 860 |
| 85 | Ga0466735_028461 | 3300042624 | Unclassified | 2051 |
| 86 | Ga0466704_346326 | 3300042643 | Bacteria | 12308 |
| 87 | Ga0466704_356191 | 3300042643 | Bacteria | 12583 |
| 88 | Ga0466701_095501 | 3300042598 | Bacteria | 1788 |
| 89 | Ga0466706_228063 | 3300042599 | Bacteria | 76616 |
| 90 | Ga0466700_108288 | 3300042600 | Bacteria | 3576 |
| 91 | JGI24702J35022_10000938 | 3300002462 | Bacteria | 18220 |
| 92 | JGI24702J35022_10033552 | 3300002462 | Unclassified | 2746 |
| 93 | Ga0123357_10006878 | 3300009784 | Bacteria | 13978 |
| 94 | Ga0123353_10283100 | 3300010167 | Bacteria | 2544 |
| 95 | Ga0123353_11033718 | 3300010167 | Bacteria | 1100 |
| 96 | Ga0466725_259771 | 3300042654 | Bacteria | 67209 |
| 97 | Ga0466706_243926 | 3300042599 | Bacteria | 39041 |
| 98 | Ga0466700_013292 | 3300042600 | Bacteria | 7892 |
| 99 | Ga0466700_042129 | 3300042600 | Bacteria | 4731 |
| 100 | JGI24702J35022_10011690 | 3300002462 | Bacteria | 4894 |
| 101 | JGI24702J35022_10011753 | 3300002462 | Bacteria | 4878 |
| 102 | JGI24702J35022_10242513 | 3300002462 | Bacteria | 1046 |
| 103 | JGI24705J35276_12228173 | 3300002504 | Bacteria | 3136 |
| 104 | Ga0072941_1355729 | 3300005201 | Bacteria | 3204 |
| 105 | Ga0466711_398758 | 3300042615 | Bacteria | 47200 |
| 106 | Ga0466718_162702 | 3300042617 | Bacteria | 1334 |
| 107 | Ga0466728_395421 | 3300042620 | Bacteria | 9433 |
| 108 | Ga0123354_10003600 | 3300010882 | Bacteria | 21472 |
| 109 | Ga0466735_057728 | 3300042624 | Bacteria | 1293 |
| 110 | Ga0466703_246818 | 3300042636 | Bacteria | 6901 |
| 111 | Ga0466700_362672 | 3300042600 | Bacteria | 1225 |
| 112 | Ga0466713_080325 | 3300042602 | Bacteria | 9022 |
| 113 | JGI24702J35022_10015420 | 3300002462 | Bacteria | 4205 |
| 114 | JGI24702J35022_10131250 | 3300002462 | Bacteria | 1391 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00364 | Biotin_lipoyl | Biotin-requiring enzyme | 114 | 178 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.