Protein Family IF05749
Metagenome
Isolate
191
Members
67
Samples
169
Scaffolds
310.41
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_372371|Ga0466700_372371_2120_3049
- Length
- 309 aa
- Sequence
- MKGLVVKNTGSWYLVKTDGGRLIETKLKGNFRLKEIKSTNPVAVGDWVLIEENQEGTAFIYEIEDRKNYIIRRSSNLSKQSHVIAANVDQAFLIVTVNYPVTTTTFIDRFLATAEAYRIPAFLFFNKMDRYSSEDREYVEALIYLYETIGYTCHKISALEDNLLFMLQLLKNKTTLFSGHSGVGKSTLINRLEPNAQLRTREISNYHNKGMHTTTFSEMIKLSGGGYIIDTPGIKGFGVFDMESVEVSHYFPEIFKFAESCKFNNCTHRKEPGCAVLQALKDNYISESRYRSYLNILDDEAGKKYREAF
Sample Types
Isolate
11.5%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
26.9%
Termitidae
26.9%
Kalotermitidae
20.9%
Unclassified
10.4%
Termopsidae
6.0%
Rhinotermitidae
4.5%
Passalidae
3.0%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 3 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 4 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 5 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 21 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 22 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 23 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 30 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 31 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 45 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 46 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 47 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 48 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 53 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 58 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 59 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 60 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 61 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_053829 | 3300042659 | Bacteria | 74295 |
| 2 | Ga0123357_10048971 | 3300009784 | Bacteria | 5724 |
| 3 | Ga0123354_10001542 | 3300010882 | Bacteria | 28227 |
| 4 | Ga0466723_250630 | 3300042618 | Bacteria | 3025 |
| 5 | Ga0466728_155675 | 3300042620 | Bacteria | 7340 |
| 6 | Ga0466713_044168 | 3300042602 | Bacteria | 23186 |
| 7 | Ga0466713_137512 | 3300042602 | Bacteria | 13469 |
| 8 | Ga0466716_281169 | 3300042605 | Bacteria | 5161 |
| 9 | Ga0466719_043916 | 3300042606 | Bacteria | 13096 |
| 10 | Ga0466719_372237 | 3300042606 | Bacteria | 8104 |
| 11 | Ga0466719_379862 | 3300042606 | Bacteria | 2643 |
| 12 | Ga0466722_165113 | 3300042609 | Bacteria | 35000 |
| 13 | Ga0466690_061290 | 3300042590 | Bacteria | 39636 |
| 14 | Ga0466696_374554 | 3300042596 | Bacteria | 7120 |
| 15 | 2227661312 | 2225789004 | Bacteria | 1946 |
| 16 | Ga0466735_166303 | 3300042624 | Bacteria | 1863 |
| 17 | Ga0466704_404355 | 3300042643 | Bacteria | 3624 |
| 18 | Ga0466709_285479 | 3300042648 | Bacteria | 36223 |
| 19 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 20 | Ga0123357_10064151 | 3300009784 | Bacteria | 4910 |
| 21 | Ga0123354_10332567 | 3300010882 | Bacteria | 1382 |
| 22 | Ga0466711_432914 | 3300042615 | Bacteria | 1511 |
| 23 | Ga0466715_231121 | 3300042616 | Bacteria | 27941 |
| 24 | Ga0466726_113886 | 3300042619 | Unclassified | 1167 |
| 25 | Ga0466726_266114 | 3300042619 | Bacteria | 14251 |
| 26 | Ga0466713_015028 | 3300042602 | Bacteria | 18923 |
| 27 | Ga0466713_068915 | 3300042602 | Bacteria | 3944 |
| 28 | Ga0466722_058847 | 3300042609 | Bacteria | 5707 |
| 29 | Ga0466722_150021 | 3300042609 | Bacteria | 11279 |
| 30 | Ga0466690_145185 | 3300042590 | Bacteria | 12761 |
| 31 | Ga0466690_218433 | 3300042590 | Bacteria | 3017 |
| 32 | Ga0466690_340718 | 3300042590 | Bacteria | 6390 |
| 33 | Ga0466696_010174 | 3300042596 | Bacteria | 34499 |
| 34 | Ga0466696_345175 | 3300042596 | Bacteria | 10393 |
| 35 | IMNBL1DRAFT_c0000378 | 3300000062 | Bacteria | 38118 |
| 36 | IMNBL1DRAFT_c0000967 | 3300000062 | Bacteria | 22204 |
| 37 | JGI24702J35022_10004410 | 3300002462 | Bacteria | 8359 |
| 38 | JGI24699J35502_11134056 | 3300002509 | Bacteria | 27277 |
| 39 | JGI24696J40584_12955073 | 3300002834 | Bacteria | 2756 |
| 40 | Ga0123357_10001231 | 3300009784 | Bacteria | 26869 |
| 41 | Ga0466735_098167 | 3300042624 | Bacteria | 1805 |
| 42 | Ga0466735_136106 | 3300042624 | Bacteria | 20578 |
| 43 | Ga0466703_081086 | 3300042636 | Bacteria | 13969 |
| 44 | Ga0466704_073513 | 3300042643 | Bacteria | 6622 |
| 45 | Ga0466704_162591 | 3300042643 | Bacteria | 14624 |
| 46 | Ga0466708_175500 | 3300042652 | Bacteria | 17846 |
| 47 | Ga0466727_259633 | 3300042655 | Bacteria | 12651 |
| 48 | Ga0123357_10008613 | 3300009784 | Bacteria | 12765 |
| 49 | Ga0123357_10030231 | 3300009784 | Bacteria | 7343 |
| 50 | Ga0123353_10100763 | 3300010167 | Bacteria | 4656 |
| 51 | Ga0123353_10121192 | 3300010167 | Bacteria | 4206 |
| 52 | Ga0123354_10039470 | 3300010882 | Bacteria | 7317 |
| 53 | Ga0123354_10236051 | 3300010882 | Bacteria | 1896 |
| 54 | Ga0466711_490041 | 3300042615 | Bacteria | 3963 |
| 55 | Ga0466715_355335 | 3300042616 | Bacteria | 7535 |
| 56 | Ga0466706_038521 | 3300042599 | Bacteria | 2347 |
| 57 | Ga0466706_206937 | 3300042599 | Bacteria | 3552 |
| 58 | Ga0466716_177205 | 3300042605 | Bacteria | 3277 |
| 59 | Ga0466722_081713 | 3300042609 | Bacteria | 4561 |
| 60 | Ga0415639_045760 | 3300038395 | Bacteria | 3223 |
| 61 | Ga0466694_227896 | 3300042594 | Bacteria | 2670 |
| 62 | Ga0466696_289866 | 3300042596 | Bacteria | 18784 |
| 63 | IMNBL1DRAFT_c0022945 | 3300000062 | Bacteria | 2456 |
| 64 | JGI24702J35022_10001025 | 3300002462 | Bacteria | 17489 |
| 65 | JGI24699J35502_11127536 | 3300002509 | Bacteria | 4176 |
| 66 | Ga0466729_239996 | 3300042621 | Bacteria | 15530 |
| 67 | Ga0466703_385649 | 3300042636 | Bacteria | 2630 |
| 68 | Ga0466727_124126 | 3300042655 | Bacteria | 7801 |
| 69 | Ga0466732_439102 | 3300042656 | Bacteria | 1749 |
| 70 | Ga0466715_076359 | 3300042616 | Bacteria | 15631 |
| 71 | Ga0466715_120453 | 3300042616 | Unclassified | 2215 |
| 72 | Ga0466729_157648 | 3300042621 | Bacteria | 1338 |
| 73 | Ga0466707_093234 | 3300042601 | Bacteria | 3556 |
| 74 | Ga0466713_034284 | 3300042602 | Bacteria | 9067 |
| 75 | Ga0466713_045654 | 3300042602 | Bacteria | 11902 |
| 76 | Ga0466692_042719 | 3300042591 | Bacteria | 5683 |
| 77 | Ga0466692_163838 | 3300042591 | Bacteria | 4088 |
| 78 | 2227507408 | 2225789004 | Bacteria | 3639 |
| 79 | Ga0068302_10002731 | 3300005071 | Unclassified | 1954 |
| 80 | Ga0466735_054067 | 3300042624 | Bacteria | 2389 |
| 81 | Ga0466704_298510 | 3300042643 | Bacteria | 23069 |
| 82 | Ga0466704_561838 | 3300042643 | Bacteria | 29338 |
| 83 | Ga0466708_126656 | 3300042652 | Bacteria | 27676 |
| 84 | Ga0123356_10005302 | 3300010049 | Bacteria | 13145 |
| 85 | Ga0466723_113565 | 3300042618 | Bacteria | 1976 |
| 86 | Ga0466726_350196 | 3300042619 | Bacteria | 1884 |
| 87 | Ga0466700_034471 | 3300042600 | Bacteria | 17094 |
| 88 | Ga0466716_302468 | 3300042605 | Bacteria | 23384 |
| 89 | Ga0466693_209038 | 3300042592 | Bacteria | 3455 |
| 90 | Ga0466691_089505 | 3300042593 | Bacteria | 2595 |
| 91 | IMNBL1DRAFT_c0005689 | 3300000062 | Bacteria | 7038 |
| 92 | Ga0466735_013961 | 3300042624 | Bacteria | 4005 |
| 93 | Ga0466703_135491 | 3300042636 | Bacteria | 2922 |
| 94 | Ga0466725_183038 | 3300042654 | Bacteria | 1791 |
| 95 | Ga0466727_042345 | 3300042655 | Bacteria | 13374 |
| 96 | Ga0123353_10438278 | 3300010167 | Bacteria | 1929 |
| 97 | Ga0123354_10005342 | 3300010882 | Bacteria | 18635 |
| 98 | Ga0123354_10019502 | 3300010882 | Bacteria | 10651 |
| 99 | Ga0123354_10082299 | 3300010882 | Bacteria | 4539 |
| 100 | Ga0123354_10182274 | 3300010882 | Unclassified | 2391 |
| 101 | Ga0466705_391529 | 3300042612 | Bacteria | 3302 |
| 102 | Ga0466715_119675 | 3300042616 | Bacteria | 3063 |
| 103 | Ga0466726_316828 | 3300042619 | Bacteria | 2528 |
| 104 | Ga0466701_061816 | 3300042598 | Bacteria | 14165 |
| 105 | Ga0466701_079535 | 3300042598 | Bacteria | 72629 |
| 106 | Ga0466700_372371 | 3300042600 | Bacteria | 3166 |
| 107 | Ga0466707_263999 | 3300042601 | Bacteria | 16080 |
| 108 | Ga0466707_337815 | 3300042601 | Bacteria | 18263 |
| 109 | Ga0466713_056151 | 3300042602 | Bacteria | 40882 |
| 110 | Ga0466716_467442 | 3300042605 | Bacteria | 25909 |
| 111 | Ga0466722_206920 | 3300042609 | Bacteria | 1887 |
| 112 | Ga0466690_266719 | 3300042590 | Bacteria | 2839 |
| 113 | Ga0466692_067548 | 3300042591 | Bacteria | 10110 |
| 114 | Ga0466692_106596 | 3300042591 | Bacteria | 5339 |
| 115 | 2227572419 | 2225789004 | Bacteria | 2600 |
| 116 | Ga0068305_10321584 | 3300005083 | Bacteria | 7639 |
| 117 | Ga0123357_10003012 | 3300009784 | Bacteria | 19070 |
| 118 | Ga0466703_058449 | 3300042636 | Bacteria | 2569 |
| 119 | Ga0466703_261320 | 3300042636 | Bacteria | 41798 |
| 120 | Ga0466704_397024 | 3300042643 | Bacteria | 8534 |
| 121 | Ga0466727_311789 | 3300042655 | Bacteria | 6585 |
| 122 | Ga0466705_284343 | 3300042612 | Bacteria | 14433 |
| 123 | Ga0123357_10010334 | 3300009784 | Bacteria | 11862 |
| 124 | Ga0466711_036479 | 3300042615 | Bacteria | 1943 |
| 125 | Ga0466715_229277 | 3300042616 | Bacteria | 9485 |
| 126 | Ga0466726_440172 | 3300042619 | Bacteria | 1356 |
| 127 | Ga0466706_034341 | 3300042599 | Bacteria | 6872 |
| 128 | Ga0466700_102266 | 3300042600 | Bacteria | 11894 |
| 129 | Ga0466707_010780 | 3300042601 | Bacteria | 2007 |
| 130 | Ga0466707_058532 | 3300042601 | Bacteria | 2511 |
| 131 | Ga0466707_104360 | 3300042601 | Bacteria | 4998 |
| 132 | Ga0466707_115472 | 3300042601 | Bacteria | 2507 |
| 133 | Ga0466719_187556 | 3300042606 | Bacteria | 2610 |
| 134 | IMNBL1DRAFT_c0000550 | 3300000062 | Bacteria | 30486 |
| 135 | IMNBL1DRAFT_c0007528 | 3300000062 | Bacteria | 5707 |
| 136 | Ga0466734_154640 | 3300042623 | Bacteria | 2508 |
| 137 | Ga0466703_069218 | 3300042636 | Bacteria | 5838 |
| 138 | Ga0466703_076148 | 3300042636 | Bacteria | 31788 |
| 139 | Ga0466704_397789 | 3300042643 | Bacteria | 8757 |
| 140 | Ga0466704_504980 | 3300042643 | Bacteria | 9197 |
| 141 | Ga0466709_218965 | 3300042648 | Bacteria | 23200 |
| 142 | Ga0466727_164388 | 3300042655 | Bacteria | 3664 |
| 143 | Ga0466727_272373 | 3300042655 | Bacteria | 4367 |
| 144 | Ga0466697_080810 | 3300042611 | Bacteria | 1598 |
| 145 | Ga0123354_10017098 | 3300010882 | Bacteria | 11360 |
| 146 | Ga0466715_222839 | 3300042616 | Bacteria | 6079 |
| 147 | Ga0466715_484239 | 3300042616 | Bacteria | 11010 |
| 148 | Ga0466700_036651 | 3300042600 | Bacteria | 2758 |
| 149 | Ga0466707_111695 | 3300042601 | Bacteria | 37145 |
| 150 | Ga0466707_227488 | 3300042601 | Bacteria | 8168 |
| 151 | Ga0466707_305705 | 3300042601 | Bacteria | 37461 |
| 152 | Ga0466713_117267 | 3300042602 | Bacteria | 44157 |
| 153 | Ga0466719_219052 | 3300042606 | Bacteria | 2872 |
| 154 | Ga0466722_136436 | 3300042609 | Bacteria | 9717 |
| 155 | Ga0466722_172122 | 3300042609 | Bacteria | 4339 |
| 156 | Ga0466698_327631 | 3300042610 | Bacteria | 1883 |
| 157 | Ga0466690_404209 | 3300042590 | Bacteria | 3172 |
| 158 | Ga0466692_181143 | 3300042591 | Bacteria | 18569 |
| 159 | Ga0466691_195452 | 3300042593 | Bacteria | 11459 |
| 160 | 2227080821 | 2225789004 | Bacteria | 10122 |
| 161 | IMNBL1DRAFT_c0009894 | 3300000062 | Bacteria | 4640 |
| 162 | JGI24699J35502_11134045 | 3300002509 | Bacteria | 26658 |
| 163 | JGI24696J40584_12951810 | 3300002834 | Bacteria | 2280 |
| 164 | Ga0466735_072645 | 3300042624 | Bacteria | 6232 |
| 165 | Ga0466703_116337 | 3300042636 | Bacteria | 5231 |
| 166 | Ga0466704_210305 | 3300042643 | Bacteria | 5928 |
| 167 | Ga0466704_557681 | 3300042643 | Bacteria | 20638 |
| 168 | Ga0466709_083260 | 3300042648 | Bacteria | 4447 |
| 169 | Ga0466709_281727 | 3300042648 | Bacteria | 6076 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.