Protein Family IF05665
Metagenome
Isolate
115
Members
44
Samples
110
Scaffolds
161.98
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_208166|Ga0466706_208166_291_764
- Length
- 157 aa
- Sequence
- MDISESDITAVIDNYPKEERYSLAILQDLQRRFGYIPKEAFPLVGKHLGMKVAQLYAMATFYKALSLKPKGKHVIKVCDGTACHLRGAPTLLDALKRLDLTPGETTPDGEFSLETVNCLGACAIAPVMVVDDTYFPKVKPDNVGEIITKYKVDYYDK
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.8%
Unclassified
18.2%
Kalotermitidae
11.4%
Termopsidae
6.8%
Rhinotermitidae
4.5%
Hodotermitidae
2.3%
Taxonomy
Archaea
2
Bacteria
100
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 41 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466708_022547 | 3300042652 | Bacteria | 24140 |
| 2 | Ga0466712_020332 | 3300042614 | Bacteria | 4476 |
| 3 | Ga0466718_147204 | 3300042617 | Bacteria | 1413 |
| 4 | Ga0123357_10094544 | 3300009784 | Unclassified | 3879 |
| 5 | Ga0123356_10015730 | 3300010049 | Bacteria | 7241 |
| 6 | Ga0123356_10082823 | 3300010049 | Bacteria | 3038 |
| 7 | Ga0123356_11390402 | 3300010049 | Bacteria | 863 |
| 8 | Ga0123356_11611548 | 3300010049 | Bacteria | 803 |
| 9 | Ga0123353_10021906 | 3300010167 | Bacteria | 9607 |
| 10 | Ga0123353_10468058 | 3300010167 | Bacteria | 1849 |
| 11 | Ga0123353_10915493 | 3300010167 | Unclassified | 1192 |
| 12 | Ga0123353_11486753 | 3300010167 | Bacteria | 864 |
| 13 | Ga0123353_12860869 | 3300010167 | Bacteria | 564 |
| 14 | Ga0123354_10390517 | 3300010882 | Bacteria | 1190 |
| 15 | Ga0466706_226464 | 3300042599 | Unclassified | 3962 |
| 16 | Ga0466714_050507 | 3300042603 | Unclassified | 1378 |
| 17 | Ga0466720_139327 | 3300042607 | Bacteria | 23939 |
| 18 | Ga0466722_180683 | 3300042609 | Bacteria | 6635 |
| 19 | Ga0466698_254248 | 3300042610 | Bacteria | 1009 |
| 20 | Ga0466698_392245 | 3300042610 | Bacteria | 1197 |
| 21 | JGI24698J34947_10146961 | 3300002449 | Bacteria | 984 |
| 22 | Ga0068302_10123096 | 3300005071 | Bacteria | 3985 |
| 23 | Ga0466694_115375 | 3300042594 | Bacteria | 5041 |
| 24 | Ga0466699_295407 | 3300042597 | Bacteria | 1548 |
| 25 | Ga0466699_330569 | 3300042597 | Bacteria | 1241 |
| 26 | Ga0466711_426956 | 3300042615 | Bacteria | 1616 |
| 27 | Ga0123353_10179575 | 3300010167 | Bacteria | 3353 |
| 28 | Ga0123353_10230302 | 3300010167 | Unclassified | 2889 |
| 29 | Ga0123353_10656923 | 3300010167 | Unclassified | 1483 |
| 30 | Ga0466700_154059 | 3300042600 | Bacteria | 2997 |
| 31 | Ga0466707_381054 | 3300042601 | Bacteria | 4648 |
| 32 | Ga0466713_131539 | 3300042602 | Bacteria | 12213 |
| 33 | Ga0466713_134445 | 3300042602 | Bacteria | 8280 |
| 34 | JGI24698J34947_10003354 | 3300002449 | Bacteria | 8694 |
| 35 | Ga0466708_249259 | 3300042652 | Bacteria | 1660 |
| 36 | Ga0466725_058890 | 3300042654 | Bacteria | 1437 |
| 37 | Ga0123357_10104309 | 3300009784 | Bacteria | 3641 |
| 38 | Ga0123353_10019187 | 3300010167 | Bacteria | 10147 |
| 39 | Ga0123353_10100206 | 3300010167 | Unclassified | 4669 |
| 40 | Ga0123353_10140033 | 3300010167 | Bacteria | 3876 |
| 41 | Ga0123353_10658356 | 3300010167 | Bacteria | 1481 |
| 42 | AustNasuHG_c1017010 | 3300000089 | Bacteria | 2425 |
| 43 | JGI24702J35022_10328912 | 3300002462 | Bacteria | 908 |
| 44 | Ga0466694_326746 | 3300042594 | Bacteria | 1022 |
| 45 | Ga0466712_036085 | 3300042614 | Bacteria | 1696 |
| 46 | Ga0123353_10029440 | 3300010167 | Bacteria | 8463 |
| 47 | Ga0123353_10037702 | 3300010167 | Bacteria | 7585 |
| 48 | Ga0123353_10107525 | 3300010167 | Bacteria | 4495 |
| 49 | Ga0466707_238219 | 3300042601 | Bacteria | 1357 |
| 50 | Ga0466719_005449 | 3300042606 | Bacteria | 6404 |
| 51 | AustNasuHG_c1037624 | 3300000089 | Bacteria | 1232 |
| 52 | JGI24698J34947_10144450 | 3300002449 | Bacteria | 997 |
| 53 | JGI24702J35022_10004188 | 3300002462 | Bacteria | 8613 |
| 54 | JGI24705J35276_12174680 | 3300002504 | Bacteria | 1319 |
| 55 | Ga0072940_1048732 | 3300005200 | Bacteria | 2915 |
| 56 | Ga0074263_101967 | 3300005485 | Bacteria | 2098 |
| 57 | Ga0466695_254507 | 3300042595 | Bacteria | 7211 |
| 58 | Ga0466732_022904 | 3300042656 | Bacteria | 1044 |
| 59 | Ga0466702_199585 | 3300042635 | Bacteria | 1026 |
| 60 | Ga0466703_032096 | 3300042636 | Bacteria | 6501 |
| 61 | Ga0466724_06057 | 3300042649 | Bacteria | 1105 |
| 62 | Ga0466712_148640 | 3300042614 | Unclassified | 1197 |
| 63 | Ga0123356_10766169 | 3300010049 | Archaea | 1135 |
| 64 | Ga0123353_10473938 | 3300010167 | Bacteria | 1834 |
| 65 | Ga0123353_10708376 | 3300010167 | Unclassified | 1411 |
| 66 | Ga0466706_208166 | 3300042599 | Bacteria | 1795 |
| 67 | Ga0466707_209030 | 3300042601 | Bacteria | 3980 |
| 68 | Ga0466717_110135 | 3300042604 | Bacteria | 2038 |
| 69 | Ga0466717_179904 | 3300042604 | Bacteria | 1283 |
| 70 | Ga0466719_112688 | 3300042606 | Bacteria | 1835 |
| 71 | Ga0466722_245017 | 3300042609 | Bacteria | 1379 |
| 72 | JGI24702J35022_10033713 | 3300002462 | Bacteria | 2739 |
| 73 | JGI24702J35022_10164297 | 3300002462 | Bacteria | 1252 |
| 74 | Ga0466694_261335 | 3300042594 | Bacteria | 1248 |
| 75 | Ga0466699_045973 | 3300042597 | Bacteria | 1167 |
| 76 | Ga0466699_274103 | 3300042597 | Bacteria | 22431 |
| 77 | Ga0466732_422140 | 3300042656 | Unclassified | 1257 |
| 78 | Ga0466729_136223 | 3300042621 | Bacteria | 1629 |
| 79 | Ga0123353_10181405 | 3300010167 | Bacteria | 3332 |
| 80 | Ga0123353_10277331 | 3300010167 | Bacteria | 2578 |
| 81 | Ga0123353_10377739 | 3300010167 | Bacteria | 2121 |
| 82 | Ga0123353_10933301 | 3300010167 | Bacteria | 1176 |
| 83 | Ga0123353_11040015 | 3300010167 | Bacteria | 1095 |
| 84 | Ga0123353_11230767 | 3300010167 | Bacteria | 979 |
| 85 | Ga0123353_11507400 | 3300010167 | Unclassified | 856 |
| 86 | Ga0466706_232771 | 3300042599 | Unclassified | 1296 |
| 87 | Ga0466707_177086 | 3300042601 | Bacteria | 1071 |
| 88 | Ga0466717_205037 | 3300042604 | Bacteria | 1720 |
| 89 | JGI24698J34947_10164830 | 3300002449 | Bacteria | 903 |
| 90 | Ga0068305_10211808 | 3300005083 | Bacteria | 21588 |
| 91 | Ga0072940_1001194 | 3300005200 | Bacteria | 2221 |
| 92 | Ga0415639_188468 | 3300038395 | Bacteria | 1555 |
| 93 | Ga0466694_060269 | 3300042594 | Bacteria | 2912 |
| 94 | Ga0466732_275608 | 3300042656 | Bacteria | 1027 |
| 95 | Ga0466727_290839 | 3300042655 | Bacteria | 2143 |
| 96 | Ga0466715_587933 | 3300042616 | Bacteria | 8127 |
| 97 | Ga0466726_073137 | 3300042619 | Unclassified | 5734 |
| 98 | Ga0123357_10072737 | 3300009784 | Bacteria | 4554 |
| 99 | Ga0123356_11620149 | 3300010049 | Bacteria | 801 |
| 100 | Ga0123353_10242895 | 3300010167 | Bacteria | 2796 |
| 101 | Ga0123353_10759775 | 3300010167 | Bacteria | 1347 |
| 102 | Ga0466698_092520 | 3300042610 | Bacteria | 1221 |
| 103 | Ga0072940_1031009 | 3300005200 | Bacteria | 9661 |
| 104 | Ga0123353_10600914 | 3300010167 | Bacteria | 1572 |
| 105 | Ga0123353_11027298 | 3300010167 | Bacteria | 1104 |
| 106 | Ga0466720_045768 | 3300042607 | Bacteria | 15225 |
| 107 | JGI24702J35022_10001510 | 3300002462 | Bacteria | 14448 |
| 108 | Ga0466694_068630 | 3300042594 | Archaea | 4843 |
| 109 | Ga0466694_073685 | 3300042594 | Bacteria | 2124 |
| 110 | Ga0466694_239432 | 3300042594 | Bacteria | 2709 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01257 | 2Fe-2S_thioredx | Thioredoxin-like [2Fe-2S] ferredoxin | 9 | 151 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.