Protein Family IF05601
Metagenome
Isolate
234
Members
55
Samples
223
Scaffolds
295.08
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_089174|Ga0466706_089174_208_1137
- Length
- 300 aa
- Sequence
- LSVWPATPQSEEAALAVVTMKNLLESGVHFGHQVKRWDPRMKKYIFTARNGIHIIDLQKTIEASKKAYAAVREVVAKQKTVLFVGTKKQAQQTIQKEAERCSQFYVNHRWLGGMLTNFSTIKKSLMRLKKLEKMEVDGTYEKFTKKEVASLNLGGIKEMKELPGVLFVVDTRKEAIAVAEARRCGIPVVAVVDTNCNPEGIDYPIPGNDDAIRAITLFTQIIANAVCDEDNEAGLRVIEAGEDEEDIDSFADAAPKIEDTDVDISSYHEENATDDAQNVPFTGEEEEIPADVDKVYETTE
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.0%
Kalotermitidae
25.9%
Unclassified
22.2%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Blaberidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
1
Bacteria
225
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 18 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 19 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 20 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 38 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 39 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 40 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 41 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 42 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_159063 | 3300042612 | Bacteria | 29912 |
| 2 | Ga0466705_203115 | 3300042612 | Bacteria | 8798 |
| 3 | Ga0466705_290524 | 3300042612 | Bacteria | 10806 |
| 4 | Ga0466733_020853 | 3300042659 | Bacteria | 1151 |
| 5 | JGI24695J34938_10000095 | 3300002450 | Bacteria | 77781 |
| 6 | JGI24695J34938_10015091 | 3300002450 | Bacteria | 3976 |
| 7 | Ga0072940_1027272 | 3300005200 | Bacteria | 2603 |
| 8 | Ga0466691_002003 | 3300042593 | Bacteria | 13641 |
| 9 | Ga0466691_041727 | 3300042593 | Bacteria | 2979 |
| 10 | Ga0466699_185985 | 3300042597 | Bacteria | 14320 |
| 11 | Ga0123356_10018720 | 3300010049 | Bacteria | 6573 |
| 12 | Ga0466711_095322 | 3300042615 | Bacteria | 5363 |
| 13 | Ga0466711_264869 | 3300042615 | Bacteria | 5290 |
| 14 | Ga0466711_342591 | 3300042615 | Bacteria | 80397 |
| 15 | Ga0466715_024197 | 3300042616 | Bacteria | 15864 |
| 16 | Ga0466718_155753 | 3300042617 | Bacteria | 1419 |
| 17 | Ga0466723_367953 | 3300042618 | Bacteria | 11886 |
| 18 | Ga0466726_262699 | 3300042619 | Bacteria | 1290 |
| 19 | Ga0466726_285306 | 3300042619 | Bacteria | 8323 |
| 20 | Ga0466726_494667 | 3300042619 | Bacteria | 1655 |
| 21 | Ga0466731_002045 | 3300042622 | Bacteria | 3793 |
| 22 | Ga0466703_009979 | 3300042636 | Bacteria | 2299 |
| 23 | Ga0466703_132938 | 3300042636 | Bacteria | 17353 |
| 24 | Ga0466704_132165 | 3300042643 | Bacteria | 35160 |
| 25 | Ga0466708_031998 | 3300042652 | Bacteria | 7393 |
| 26 | Ga0466708_103796 | 3300042652 | Bacteria | 41820 |
| 27 | Ga0466708_130083 | 3300042652 | Bacteria | 4488 |
| 28 | Ga0466708_133639 | 3300042652 | Bacteria | 3339 |
| 29 | Ga0466708_179777 | 3300042652 | Bacteria | 9472 |
| 30 | Ga0466727_208829 | 3300042655 | Bacteria | 4007 |
| 31 | Ga0466716_156962 | 3300042605 | Bacteria | 2515 |
| 32 | Ga0466716_160781 | 3300042605 | Bacteria | 1910 |
| 33 | Ga0466722_169113 | 3300042609 | Bacteria | 13744 |
| 34 | Ga0466722_243309 | 3300042609 | Bacteria | 1254 |
| 35 | Ga0466705_182822 | 3300042612 | Bacteria | 4992 |
| 36 | AustNasuHG_c1005467 | 3300000089 | Bacteria | 4542 |
| 37 | JGI24698J34947_10065391 | 3300002449 | Bacteria | 1773 |
| 38 | Ga0466691_079924 | 3300042593 | Bacteria | 2710 |
| 39 | Ga0466691_089860 | 3300042593 | Bacteria | 3765 |
| 40 | Ga0466705_507020 | 3300042612 | Bacteria | 11145 |
| 41 | Ga0466712_173060 | 3300042614 | Bacteria | 15755 |
| 42 | Ga0466715_007052 | 3300042616 | Bacteria | 1686 |
| 43 | Ga0466715_041382 | 3300042616 | Bacteria | 5685 |
| 44 | Ga0466723_082727 | 3300042618 | Bacteria | 2467 |
| 45 | Ga0466726_291072 | 3300042619 | Bacteria | 2974 |
| 46 | Ga0466726_467527 | 3300042619 | Bacteria | 17786 |
| 47 | Ga0466728_179610 | 3300042620 | Bacteria | 19510 |
| 48 | Ga0466735_077974 | 3300042624 | Bacteria | 16776 |
| 49 | Ga0466703_044787 | 3300042636 | Bacteria | 35925 |
| 50 | Ga0466703_337384 | 3300042636 | Bacteria | 14779 |
| 51 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 52 | Ga0466704_362254 | 3300042643 | Bacteria | 10532 |
| 53 | Ga0466704_513106 | 3300042643 | Bacteria | 10178 |
| 54 | Ga0466708_063073 | 3300042652 | Bacteria | 4338 |
| 55 | Ga0466708_187629 | 3300042652 | Bacteria | 7619 |
| 56 | Ga0466708_216326 | 3300042652 | Bacteria | 2152 |
| 57 | Ga0466727_051782 | 3300042655 | Bacteria | 5573 |
| 58 | Ga0466727_305303 | 3300042655 | Bacteria | 3491 |
| 59 | Ga0466722_004303 | 3300042609 | Bacteria | 62419 |
| 60 | Ga0466722_068601 | 3300042609 | Archaea | 8995 |
| 61 | Ga0466705_020234 | 3300042612 | Unclassified | 2777 |
| 62 | Ga0466705_044505 | 3300042612 | Bacteria | 1738 |
| 63 | AustNasuHG_c1000551 | 3300000089 | Bacteria | 13181 |
| 64 | JGI24695J34938_10002961 | 3300002450 | Bacteria | 12256 |
| 65 | JGI24695J34938_10089483 | 3300002450 | Bacteria | 1264 |
| 66 | Ga0466690_313579 | 3300042590 | Bacteria | 41778 |
| 67 | Ga0466699_021544 | 3300042597 | Bacteria | 70828 |
| 68 | Ga0466699_145290 | 3300042597 | Bacteria | 1828 |
| 69 | Ga0466705_448911 | 3300042612 | Bacteria | 17091 |
| 70 | Ga0466711_036291 | 3300042615 | Bacteria | 46909 |
| 71 | Ga0466711_192869 | 3300042615 | Bacteria | 2218 |
| 72 | Ga0466711_290578 | 3300042615 | Bacteria | 14399 |
| 73 | Ga0466715_098486 | 3300042616 | Unclassified | 2814 |
| 74 | Ga0466715_106124 | 3300042616 | Bacteria | 7437 |
| 75 | Ga0466718_148910 | 3300042617 | Bacteria | 34374 |
| 76 | Ga0466723_024654 | 3300042618 | Bacteria | 62216 |
| 77 | Ga0466723_122308 | 3300042618 | Bacteria | 3144 |
| 78 | Ga0466728_055598 | 3300042620 | Bacteria | 38254 |
| 79 | Ga0466728_278419 | 3300042620 | Bacteria | 4440 |
| 80 | Ga0466703_159061 | 3300042636 | Bacteria | 19395 |
| 81 | Ga0466703_205989 | 3300042636 | Bacteria | 9076 |
| 82 | Ga0466704_040140 | 3300042643 | Bacteria | 12885 |
| 83 | Ga0466704_163676 | 3300042643 | Bacteria | 22512 |
| 84 | Ga0466708_009999 | 3300042652 | Bacteria | 25991 |
| 85 | Ga0466708_072692 | 3300042652 | Bacteria | 2314 |
| 86 | Ga0466708_107121 | 3300042652 | Bacteria | 2369 |
| 87 | Ga0466727_087070 | 3300042655 | Bacteria | 1007 |
| 88 | Ga0466727_289668 | 3300042655 | Bacteria | 2657 |
| 89 | Ga0466719_160884 | 3300042606 | Bacteria | 7295 |
| 90 | Ga0466719_425589 | 3300042606 | Bacteria | 12270 |
| 91 | Ga0466722_214297 | 3300042609 | Bacteria | 2430 |
| 92 | Ga0466698_201008 | 3300042610 | Bacteria | 2825 |
| 93 | AustNasuHG_c1030056 | 3300000089 | Unclassified | 1573 |
| 94 | JGI24695J34938_10069097 | 3300002450 | Bacteria | 1482 |
| 95 | Ga0072941_1001996 | 3300005201 | Bacteria | 50262 |
| 96 | Ga0466691_086049 | 3300042593 | Bacteria | 30046 |
| 97 | Ga0466696_063750 | 3300042596 | Bacteria | 11754 |
| 98 | Ga0466696_406506 | 3300042596 | Bacteria | 2623 |
| 99 | Ga0466696_450427 | 3300042596 | Bacteria | 17307 |
| 100 | Ga0123353_10006835 | 3300010167 | Bacteria | 15309 |
| 101 | Ga0466715_249785 | 3300042616 | Bacteria | 7306 |
| 102 | Ga0466723_291555 | 3300042618 | Bacteria | 20915 |
| 103 | Ga0466703_197998 | 3300042636 | Bacteria | 15132 |
| 104 | Ga0466703_380717 | 3300042636 | Bacteria | 5510 |
| 105 | Ga0466709_086604 | 3300042648 | Bacteria | 9127 |
| 106 | Ga0466709_108611 | 3300042648 | Bacteria | 13737 |
| 107 | Ga0466709_261143 | 3300042648 | Bacteria | 5530 |
| 108 | Ga0466708_090580 | 3300042652 | Bacteria | 2331 |
| 109 | Ga0466706_089174 | 3300042599 | Bacteria | 1795 |
| 110 | Ga0466707_287046 | 3300042601 | Bacteria | 2696 |
| 111 | Ga0466713_028212 | 3300042602 | Bacteria | 5051 |
| 112 | Ga0466722_035457 | 3300042609 | Bacteria | 25393 |
| 113 | Ga0466690_159409 | 3300042590 | Bacteria | 7401 |
| 114 | Ga0466692_083116 | 3300042591 | Bacteria | 14633 |
| 115 | Ga0466691_158896 | 3300042593 | Bacteria | 91295 |
| 116 | Ga0466691_188502 | 3300042593 | Bacteria | 7508 |
| 117 | Ga0466694_043546 | 3300042594 | Bacteria | 51657 |
| 118 | Ga0466715_257116 | 3300042616 | Bacteria | 2546 |
| 119 | Ga0466718_090333 | 3300042617 | Unclassified | 4722 |
| 120 | Ga0466723_251584 | 3300042618 | Bacteria | 6315 |
| 121 | Ga0466723_361425 | 3300042618 | Bacteria | 33931 |
| 122 | Ga0466726_050069 | 3300042619 | Bacteria | 2029 |
| 123 | Ga0466728_388408 | 3300042620 | Bacteria | 3421 |
| 124 | Ga0466704_182356 | 3300042643 | Bacteria | 27760 |
| 125 | Ga0466704_288422 | 3300042643 | Bacteria | 11514 |
| 126 | Ga0466708_031869 | 3300042652 | Bacteria | 25889 |
| 127 | Ga0466708_229137 | 3300042652 | Bacteria | 6792 |
| 128 | Ga0466727_181711 | 3300042655 | Bacteria | 1021 |
| 129 | Ga0466706_193876 | 3300042599 | Bacteria | 1442 |
| 130 | Ga0466706_279270 | 3300042599 | Bacteria | 1170 |
| 131 | Ga0466707_299902 | 3300042601 | Bacteria | 2932 |
| 132 | Ga0466716_021401 | 3300042605 | Bacteria | 18251 |
| 133 | Ga0466716_207329 | 3300042605 | Bacteria | 2701 |
| 134 | Ga0466722_144391 | 3300042609 | Bacteria | 6608 |
| 135 | Ga0466698_240485 | 3300042610 | Bacteria | 1107 |
| 136 | AustNasuHG_c1003305 | 3300000089 | Unclassified | 5820 |
| 137 | JGI24695J34938_10027656 | 3300002450 | Bacteria | 2677 |
| 138 | Ga0466692_118523 | 3300042591 | Bacteria | 12566 |
| 139 | Ga0466693_245129 | 3300042592 | Bacteria | 4822 |
| 140 | Ga0466691_061757 | 3300042593 | Bacteria | 3330 |
| 141 | Ga0466691_063066 | 3300042593 | Bacteria | 1482 |
| 142 | Ga0466694_060002 | 3300042594 | Bacteria | 7248 |
| 143 | Ga0466696_137087 | 3300042596 | Bacteria | 42498 |
| 144 | Ga0123354_10131181 | 3300010882 | Bacteria | 3164 |
| 145 | Ga0466705_499395 | 3300042612 | Bacteria | 13774 |
| 146 | Ga0466715_313062 | 3300042616 | Bacteria | 2365 |
| 147 | Ga0466723_151679 | 3300042618 | Bacteria | 7363 |
| 148 | Ga0466723_166974 | 3300042618 | Bacteria | 22668 |
| 149 | Ga0466726_015760 | 3300042619 | Bacteria | 18261 |
| 150 | Ga0466726_467573 | 3300042619 | Bacteria | 15546 |
| 151 | Ga0466702_140272 | 3300042635 | Bacteria | 1267 |
| 152 | Ga0466703_076932 | 3300042636 | Bacteria | 11425 |
| 153 | Ga0466708_022120 | 3300042652 | Bacteria | 20254 |
| 154 | Ga0466708_093896 | 3300042652 | Bacteria | 20215 |
| 155 | Ga0466708_133016 | 3300042652 | Bacteria | 45331 |
| 156 | Ga0466708_135741 | 3300042652 | Bacteria | 11662 |
| 157 | Ga0466727_000412 | 3300042655 | Bacteria | 2730 |
| 158 | Ga0466706_117631 | 3300042599 | Bacteria | 2326 |
| 159 | Ga0466719_035069 | 3300042606 | Bacteria | 14650 |
| 160 | Ga0466719_445689 | 3300042606 | Bacteria | 3434 |
| 161 | Ga0466720_078453 | 3300042607 | Bacteria | 15244 |
| 162 | Ga0466722_190480 | 3300042609 | Bacteria | 2491 |
| 163 | Ga0466698_047037 | 3300042610 | Bacteria | 6895 |
| 164 | AustNasuHG_c1000392 | 3300000089 | Bacteria | 15204 |
| 165 | JGI24695J34938_10001301 | 3300002450 | Bacteria | 21804 |
| 166 | JGI24695J34938_10002164 | 3300002450 | Bacteria | 15336 |
| 167 | JGI24695J34938_10009364 | 3300002450 | Bacteria | 5453 |
| 168 | JGI24705J35276_12189570 | 3300002504 | Bacteria | 1453 |
| 169 | Ga0072941_1001986 | 3300005201 | Bacteria | 25366 |
| 170 | Ga0074263_103827 | 3300005485 | Unclassified | 1537 |
| 171 | Ga0466690_229483 | 3300042590 | Bacteria | 5441 |
| 172 | Ga0466692_188850 | 3300042591 | Bacteria | 19216 |
| 173 | Ga0466695_151841 | 3300042595 | Bacteria | 41232 |
| 174 | Ga0466696_212096 | 3300042596 | Bacteria | 3127 |
| 175 | Ga0123353_10380421 | 3300010167 | Bacteria | 2111 |
| 176 | Ga0466712_051941 | 3300042614 | Bacteria | 37403 |
| 177 | Ga0466715_213140 | 3300042616 | Bacteria | 1720 |
| 178 | Ga0466715_402823 | 3300042616 | Bacteria | 2120 |
| 179 | Ga0466718_013852 | 3300042617 | Bacteria | 2654 |
| 180 | Ga0466726_127258 | 3300042619 | Bacteria | 3476 |
| 181 | Ga0466728_252628 | 3300042620 | Bacteria | 4249 |
| 182 | Ga0466729_218848 | 3300042621 | Bacteria | 3379 |
| 183 | Ga0466735_196267 | 3300042624 | Bacteria | 2529 |
| 184 | Ga0466703_353040 | 3300042636 | Bacteria | 4047 |
| 185 | Ga0466708_134618 | 3300042652 | Bacteria | 2031 |
| 186 | Ga0466727_030252 | 3300042655 | Bacteria | 5024 |
| 187 | Ga0466727_119167 | 3300042655 | Bacteria | 13057 |
| 188 | Ga0466706_036552 | 3300042599 | Bacteria | 1708 |
| 189 | Ga0466713_112879 | 3300042602 | Bacteria | 6615 |
| 190 | Ga0466713_142588 | 3300042602 | Bacteria | 3653 |
| 191 | Ga0466720_114444 | 3300042607 | Bacteria | 17733 |
| 192 | Ga0466722_155137 | 3300042609 | Bacteria | 18198 |
| 193 | Ga0466705_226352 | 3300042612 | Bacteria | 22687 |
| 194 | JGI24698J34947_10037305 | 3300002449 | Bacteria | 2526 |
| 195 | JGI24695J34938_10000763 | 3300002450 | Bacteria | 30255 |
| 196 | JGI24695J34938_10024764 | 3300002450 | Bacteria | 2878 |
| 197 | Ga0072941_1006306 | 3300005201 | Bacteria | 12906 |
| 198 | Ga0466690_019853 | 3300042590 | Bacteria | 17279 |
| 199 | Ga0466690_190992 | 3300042590 | Bacteria | 16363 |
| 200 | Ga0466692_174397 | 3300042591 | Bacteria | 2782 |
| 201 | Ga0466691_059145 | 3300042593 | Unclassified | 2335 |
| 202 | Ga0466694_232930 | 3300042594 | Bacteria | 11790 |
| 203 | Ga0466696_085180 | 3300042596 | Bacteria | 7209 |
| 204 | Ga0466696_322152 | 3300042596 | Bacteria | 1979 |
| 205 | Ga0466711_350371 | 3300042615 | Bacteria | 2658 |
| 206 | Ga0466718_003976 | 3300042617 | Bacteria | 18604 |
| 207 | Ga0466718_068742 | 3300042617 | Bacteria | 1917 |
| 208 | Ga0466726_296695 | 3300042619 | Bacteria | 2131 |
| 209 | Ga0466731_259256 | 3300042622 | Bacteria | 1161 |
| 210 | Ga0466735_022941 | 3300042624 | Bacteria | 5732 |
| 211 | Ga0466703_330810 | 3300042636 | Bacteria | 3519 |
| 212 | Ga0466703_429093 | 3300042636 | Bacteria | 3772 |
| 213 | Ga0466704_063886 | 3300042643 | Bacteria | 26674 |
| 214 | Ga0466727_147405 | 3300042655 | Bacteria | 1178 |
| 215 | Ga0466713_077323 | 3300042602 | Bacteria | 2179 |
| 216 | Ga0466716_048303 | 3300042605 | Bacteria | 11075 |
| 217 | Ga0466716_135624 | 3300042605 | Bacteria | 11957 |
| 218 | Ga0466716_165157 | 3300042605 | Bacteria | 6307 |
| 219 | Ga0466716_173924 | 3300042605 | Bacteria | 2706 |
| 220 | Ga0466719_287701 | 3300042606 | Unclassified | 1147 |
| 221 | Ga0466719_477960 | 3300042606 | Bacteria | 1393 |
| 222 | Ga0466720_004223 | 3300042607 | Bacteria | 5708 |
| 223 | Ga0466722_029238 | 3300042609 | Bacteria | 7846 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00318 | Ribosomal_S2 | Ribosomal protein S2 | 23 | 227 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.