Protein Family IF05596
Metagenome
Isolate
223
Members
77
Samples
187
Scaffolds
424
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_086094|Ga0466706_086094_70_1542
- Length
- 482 aa
- Sequence
- METFVSPSSKPKEKYHLDTFCNRINLNVANRIRKQTKREVSNEQNHLLLGQFFKLLKVITTMKGNIKPATGRLGVLVVGVGGAVSTTLITGTLAARKGLAKAIGSITQMAMIKMKDGNEELIKDVVPLTDLNDIAFGGWDIFPDNAYEAAKYAEVLKESDLNLVKDELENIKPMSAAFDHNWAKRLNGTHIKQAATRWELVDQIRQDIRDFKAANRCERIVVLWAASTEIYIPLAKEHSSLAALEQAMQENNTTAVSPSMCYAYAALSEGAPFVMGAPNLCVDTPAMWELAEKTGMPIAGKDFKSGQTLMKTVLAPMFKTRMLGVSGWFSTNILGNRDGLVLDEPENFKTKEVSKLSVIDSIFEPEKYHKVRINYYPPRKDNKEAWDNIDFFGWMGYPMEIKVNFLCRDSILAAPIALDLVLFSDLAMRAGMSGIQTWLSFFCKSPMHDFEHEPVHDLFTQWRMVKQTIRNMVGEEAPDYLD
Sample Types
Isolate
16.1%
Metagenome
83.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
31.6%
Termitidae
18.4%
Kalotermitidae
18.4%
Unclassified
14.5%
Rhinotermitidae
5.3%
Termopsidae
3.9%
Passalidae
2.6%
Hydrophilidae
2.6%
Hodotermitidae
1.3%
Tenebrionidae
1.3%
Taxonomy
Archaea
0
Bacteria
198
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 3 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 4 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 5 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 6 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 7 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 8 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 11 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 12 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 13 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 14 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 15 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 16 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 27 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 28 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 29 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 39 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 42 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 43 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 49 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 50 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 51 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 59 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 60 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 61 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 62 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 63 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 66 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 67 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 68 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 69 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 70 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 71 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 72 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 73 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 74 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 75 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_168227 | 3300042659 | Bacteria | 3312 |
| 2 | Ga0466711_056692 | 3300042615 | Bacteria | 65775 |
| 3 | Ga0466715_165164 | 3300042616 | Bacteria | 5172 |
| 4 | Ga0466715_201004 | 3300042616 | Bacteria | 19780 |
| 5 | Ga0466715_332133 | 3300042616 | Bacteria | 83480 |
| 6 | Ga0466735_029528 | 3300042624 | Unclassified | 2717 |
| 7 | Ga0466735_085314 | 3300042624 | Unclassified | 1635 |
| 8 | Ga0466730_086978 | 3300042625 | Bacteria | 3198 |
| 9 | Ga0466703_036600 | 3300042636 | Bacteria | 3064 |
| 10 | Ga0466703_074151 | 3300042636 | Bacteria | 1762 |
| 11 | Ga0466703_228986 | 3300042636 | Bacteria | 20000 |
| 12 | Ga0466709_296893 | 3300042648 | Bacteria | 6695 |
| 13 | Ga0466727_007619 | 3300042655 | Bacteria | 7345 |
| 14 | Ga0123354_10000079 | 3300010882 | Bacteria | 73211 |
| 15 | Ga0123354_10158437 | 3300010882 | Unclassified | 2702 |
| 16 | Ga0466706_253808 | 3300042599 | Bacteria | 30096 |
| 17 | Ga0466713_015196 | 3300042602 | Bacteria | 51519 |
| 18 | Ga0466713_132210 | 3300042602 | Bacteria | 46954 |
| 19 | Ga0466716_456042 | 3300042605 | Bacteria | 9937 |
| 20 | Ga0466722_016409 | 3300042609 | Bacteria | 7511 |
| 21 | Ga0466722_127272 | 3300042609 | Unclassified | 5525 |
| 22 | Ga0466691_204801 | 3300042593 | Bacteria | 98819 |
| 23 | 2227488837 | 2225789004 | Bacteria | 4150 |
| 24 | Ga0068305_10023500 | 3300005083 | Bacteria | 10747 |
| 25 | Ga0466733_117643 | 3300042659 | Bacteria | 37134 |
| 26 | Ga0466705_429962 | 3300042612 | Bacteria | 3366 |
| 27 | Ga0466711_074652 | 3300042615 | Bacteria | 14018 |
| 28 | Ga0466711_139406 | 3300042615 | Bacteria | 2310 |
| 29 | Ga0466726_141457 | 3300042619 | Bacteria | 39794 |
| 30 | Ga0466728_145438 | 3300042620 | Bacteria | 3092 |
| 31 | Ga0466729_160138 | 3300042621 | Bacteria | 3935 |
| 32 | Ga0466735_097106 | 3300042624 | Bacteria | 5764 |
| 33 | Ga0466703_038812 | 3300042636 | Unclassified | 6375 |
| 34 | Ga0466704_262829 | 3300042643 | Bacteria | 3104 |
| 35 | Ga0466709_204961 | 3300042648 | Bacteria | 62813 |
| 36 | Ga0466708_056525 | 3300042652 | Bacteria | 81892 |
| 37 | Ga0123354_10000043 | 3300010882 | Bacteria | 94179 |
| 38 | Ga0123354_10000642 | 3300010882 | Bacteria | 36818 |
| 39 | Ga0466706_262535 | 3300042599 | Bacteria | 7632 |
| 40 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 41 | Ga0466713_109604 | 3300042602 | Bacteria | 5649 |
| 42 | Ga0466716_120361 | 3300042605 | Bacteria | 23599 |
| 43 | IMNBL1DRAFT_c0009343 | 3300000062 | Unclassified | 4849 |
| 44 | JGI24702J35022_10000732 | 3300002462 | Bacteria | 20150 |
| 45 | JGI24702J35022_10000984 | 3300002462 | Bacteria | 17840 |
| 46 | JGI24702J35022_10036228 | 3300002462 | Bacteria | 2637 |
| 47 | Ga0072941_1155917 | 3300005201 | Bacteria | 7074 |
| 48 | Ga0123357_10000303 | 3300009784 | Bacteria | 46986 |
| 49 | Ga0466711_057729 | 3300042615 | Unclassified | 4161 |
| 50 | Ga0466703_150578 | 3300042636 | Bacteria | 11848 |
| 51 | Ga0123357_10008834 | 3300009784 | Unclassified | 12649 |
| 52 | Ga0123357_10109972 | 3300009784 | Unclassified | 3519 |
| 53 | Ga0123357_10283713 | 3300009784 | Bacteria | 1705 |
| 54 | Ga0123354_10009632 | 3300010882 | Unclassified | 14823 |
| 55 | Ga0466706_172393 | 3300042599 | Bacteria | 7046 |
| 56 | Ga0466707_017405 | 3300042601 | Bacteria | 21356 |
| 57 | Ga0466692_131810 | 3300042591 | Unclassified | 6535 |
| 58 | Ga0466696_305219 | 3300042596 | Bacteria | 14116 |
| 59 | JGI24702J35022_10012449 | 3300002462 | Bacteria | 4730 |
| 60 | JGI24702J35022_10015458 | 3300002462 | Unclassified | 4201 |
| 61 | Ga0123357_10001693 | 3300009784 | Unclassified | 23735 |
| 62 | Ga0466705_293181 | 3300042612 | Bacteria | 17589 |
| 63 | Ga0466705_374407 | 3300042612 | Bacteria | 2136 |
| 64 | Ga0466705_439897 | 3300042612 | Bacteria | 6719 |
| 65 | Ga0466705_474341 | 3300042612 | Bacteria | 80430 |
| 66 | Ga0466711_127037 | 3300042615 | Bacteria | 7177 |
| 67 | Ga0466715_386675 | 3300042616 | Bacteria | 12170 |
| 68 | Ga0466723_365550 | 3300042618 | Bacteria | 29929 |
| 69 | Ga0466726_110295 | 3300042619 | Bacteria | 3230 |
| 70 | Ga0466703_275891 | 3300042636 | Bacteria | 14859 |
| 71 | Ga0466704_160875 | 3300042643 | Bacteria | 14639 |
| 72 | Ga0466704_278254 | 3300042643 | Unclassified | 7496 |
| 73 | Ga0466709_223691 | 3300042648 | Bacteria | 6073 |
| 74 | Ga0466727_106023 | 3300042655 | Bacteria | 80602 |
| 75 | Ga0123357_10007334 | 3300009784 | Unclassified | 13614 |
| 76 | Ga0123357_10109798 | 3300009784 | Bacteria | 3523 |
| 77 | Ga0123354_10002062 | 3300010882 | Bacteria | 25930 |
| 78 | Ga0123354_10082790 | 3300010882 | Bacteria | 4520 |
| 79 | Ga0466706_079529 | 3300042599 | Bacteria | 15441 |
| 80 | Ga0466706_086094 | 3300042599 | Bacteria | 1600 |
| 81 | Ga0466706_171746 | 3300042599 | Bacteria | 69301 |
| 82 | Ga0466713_025625 | 3300042602 | Bacteria | 16883 |
| 83 | Ga0466713_105016 | 3300042602 | Bacteria | 90403 |
| 84 | Ga0466690_135826 | 3300042590 | Bacteria | 15128 |
| 85 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 86 | Ga0466691_069156 | 3300042593 | Bacteria | 31255 |
| 87 | Ga0466696_370987 | 3300042596 | Bacteria | 6470 |
| 88 | Ga0466701_006486 | 3300042598 | Bacteria | 75449 |
| 89 | JGI24702J35022_10001928 | 3300002462 | Bacteria | 12790 |
| 90 | JGI24699J35502_11134009 | 3300002509 | Bacteria | 23995 |
| 91 | JGI24699J35502_11134087 | 3300002509 | Bacteria | 29356 |
| 92 | Ga0466705_329469 | 3300042612 | Bacteria | 7890 |
| 93 | Ga0466728_418631 | 3300042620 | Bacteria | 10869 |
| 94 | Ga0466729_267225 | 3300042621 | Bacteria | 7101 |
| 95 | Ga0466731_307136 | 3300042622 | Bacteria | 3153 |
| 96 | Ga0466735_116894 | 3300042624 | Bacteria | 3064 |
| 97 | Ga0466735_148387 | 3300042624 | Bacteria | 4890 |
| 98 | Ga0466703_015584 | 3300042636 | Bacteria | 6261 |
| 99 | Ga0466703_057652 | 3300042636 | Bacteria | 5819 |
| 100 | Ga0466703_108796 | 3300042636 | Bacteria | 11244 |
| 101 | Ga0466709_053597 | 3300042648 | Bacteria | 31896 |
| 102 | Ga0466708_278564 | 3300042652 | Unclassified | 7801 |
| 103 | Ga0466706_219219 | 3300042599 | Bacteria | 2436 |
| 104 | Ga0466707_170516 | 3300042601 | Bacteria | 13967 |
| 105 | Ga0466713_087636 | 3300042602 | Bacteria | 22335 |
| 106 | Ga0466719_458744 | 3300042606 | Bacteria | 3581 |
| 107 | Ga0466722_059646 | 3300042609 | Bacteria | 17780 |
| 108 | Ga0466722_061395 | 3300042609 | Bacteria | 61869 |
| 109 | Ga0466722_190847 | 3300042609 | Bacteria | 33466 |
| 110 | Ga0466698_300686 | 3300042610 | Bacteria | 4352 |
| 111 | Ga0466692_195543 | 3300042591 | Bacteria | 2670 |
| 112 | Ga0466691_079941 | 3300042593 | Bacteria | 5756 |
| 113 | 2227128018 | 2225789004 | Bacteria | 9050 |
| 114 | Ga0123357_10000713 | 3300009784 | Bacteria | 33437 |
| 115 | Ga0466705_029488 | 3300042612 | Bacteria | 74033 |
| 116 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 117 | Ga0466711_169553 | 3300042615 | Bacteria | 6485 |
| 118 | Ga0466715_180779 | 3300042616 | Bacteria | 6229 |
| 119 | Ga0466726_352151 | 3300042619 | Bacteria | 11841 |
| 120 | Ga0466729_037120 | 3300042621 | Unclassified | 7234 |
| 121 | Ga0466735_085420 | 3300042624 | Bacteria | 3397 |
| 122 | Ga0466709_347035 | 3300042648 | Bacteria | 39954 |
| 123 | Ga0466708_145242 | 3300042652 | Bacteria | 5912 |
| 124 | Ga0123357_10016737 | 3300009784 | Bacteria | 9668 |
| 125 | Ga0123354_10012702 | 3300010882 | Bacteria | 13046 |
| 126 | Ga0466706_068976 | 3300042599 | Bacteria | 62328 |
| 127 | Ga0466700_197272 | 3300042600 | Bacteria | 11382 |
| 128 | Ga0466707_082456 | 3300042601 | Bacteria | 4730 |
| 129 | Ga0466713_148297 | 3300042602 | Bacteria | 51780 |
| 130 | Ga0466716_333726 | 3300042605 | Bacteria | 23286 |
| 131 | Ga0466690_374128 | 3300042590 | Bacteria | 6307 |
| 132 | Ga0466692_107057 | 3300042591 | Bacteria | 3229 |
| 133 | Ga0466692_170277 | 3300042591 | Bacteria | 20734 |
| 134 | Ga0466692_186280 | 3300042591 | Bacteria | 12434 |
| 135 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 136 | Ga0466696_370547 | 3300042596 | Bacteria | 12464 |
| 137 | JGI24705J35276_12238649 | 3300002504 | Unclassified | 32309 |
| 138 | JGI24699J35502_11134215 | 3300002509 | Bacteria | 63583 |
| 139 | Ga0466697_096232 | 3300042611 | Bacteria | 12063 |
| 140 | Ga0466705_310377 | 3300042612 | Bacteria | 7440 |
| 141 | Ga0466733_111961 | 3300042659 | Bacteria | 105531 |
| 142 | Ga0466710_457281 | 3300042613 | Bacteria | 1549 |
| 143 | Ga0466704_087918 | 3300042643 | Bacteria | 6572 |
| 144 | Ga0466704_349686 | 3300042643 | Bacteria | 12800 |
| 145 | Ga0466709_414378 | 3300042648 | Bacteria | 23036 |
| 146 | Ga0123357_10011717 | 3300009784 | Bacteria | 11268 |
| 147 | Ga0123357_10015586 | 3300009784 | Unclassified | 9968 |
| 148 | Ga0123357_10047412 | 3300009784 | Unclassified | 5823 |
| 149 | Ga0123354_10113714 | 3300010882 | Bacteria | 3552 |
| 150 | Ga0466701_025501 | 3300042598 | Bacteria | 3867 |
| 151 | Ga0466707_170310 | 3300042601 | Bacteria | 9618 |
| 152 | Ga0466707_344958 | 3300042601 | Unclassified | 3158 |
| 153 | Ga0466707_348941 | 3300042601 | Bacteria | 2929 |
| 154 | Ga0466713_071386 | 3300042602 | Bacteria | 40802 |
| 155 | Ga0466716_119953 | 3300042605 | Bacteria | 8853 |
| 156 | Ga0466722_072432 | 3300042609 | Bacteria | 10769 |
| 157 | Ga0466722_110233 | 3300042609 | Bacteria | 35927 |
| 158 | Ga0466690_300520 | 3300042590 | Bacteria | 6112 |
| 159 | Ga0466692_052812 | 3300042591 | Bacteria | 38556 |
| 160 | Ga0466692_105261 | 3300042591 | Bacteria | 18499 |
| 161 | Ga0466696_061325 | 3300042596 | Bacteria | 2498 |
| 162 | Ga0466701_009251 | 3300042598 | Bacteria | 15413 |
| 163 | JGI24705J35276_12237534 | 3300002504 | Unclassified | 11667 |
| 164 | Ga0466733_131860 | 3300042659 | Bacteria | 5500 |
| 165 | Ga0466715_329130 | 3300042616 | Bacteria | 55839 |
| 166 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 167 | Ga0466735_137219 | 3300042624 | Bacteria | 4750 |
| 168 | Ga0466730_034027 | 3300042625 | Bacteria | 5173 |
| 169 | Ga0466704_122957 | 3300042643 | Bacteria | 17137 |
| 170 | Ga0466704_436458 | 3300042643 | Bacteria | 5601 |
| 171 | Ga0123353_10061989 | 3300010167 | Bacteria | 5999 |
| 172 | Ga0123354_10049454 | 3300010882 | Unclassified | 6376 |
| 173 | Ga0123354_10091210 | 3300010882 | Unclassified | 4212 |
| 174 | Ga0466706_027141 | 3300042599 | Bacteria | 3595 |
| 175 | Ga0466706_053861 | 3300042599 | Bacteria | 7213 |
| 176 | Ga0466706_205617 | 3300042599 | Bacteria | 35276 |
| 177 | Ga0466707_327412 | 3300042601 | Bacteria | 33932 |
| 178 | Ga0466713_107821 | 3300042602 | Bacteria | 3917 |
| 179 | Ga0466719_497203 | 3300042606 | Bacteria | 34034 |
| 180 | Ga0466690_007765 | 3300042590 | Bacteria | 18549 |
| 181 | Ga0466696_061847 | 3300042596 | Bacteria | 1797 |
| 182 | IMNBL1DRAFT_c0000854 | 3300000062 | Unclassified | 23882 |
| 183 | IMNBL1DRAFT_c0000891 | 3300000062 | Bacteria | 23227 |
| 184 | IMNBL1DRAFT_c0001910 | 3300000062 | Bacteria | 15083 |
| 185 | IMNBL1DRAFT_c0002850 | 3300000062 | Bacteria | 11620 |
| 186 | JGI24699J35502_11134085 | 3300002509 | Bacteria | 29168 |
| 187 | Ga0123357_10001196 | 3300009784 | Bacteria | 27092 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.