Protein Family IF05530
Metagenome
Isolate
334
Members
91
Samples
296
Scaffolds
258.96
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_090755|Ga0466701_090755_1216_2100
- Length
- 294 aa
- Sequence
- MSPSKRKETLEAFGRLLDVMDELREKCPWDRKQTNESLRANTIEETYELCDALMRNQPDEIKKELGDLLLHVVLYAKIGEEKGDFDIKAVCDSLCEKLIFRHPHVFGEHLTPGPSPKERGERTVGANLCVRPIEKSDTDDSRKIEQSWEQLKMKEKDGNKTVLDGVPAALPSLIKAYRIQDKARNVGFDWEVREQVWDKVQEELNELRNEIGQMNADRMEDELGDFLFSLINAARLYKINPDNALERTNQKFIRRFAYLEEHTLRQGRSLKDMTLAEMDIIWEEAKKQDSYDKE
Sample Types
Isolate
11.4%
Metagenome
88.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.0%
Termitidae
25.3%
Kalotermitidae
15.4%
Unclassified
7.7%
Rhinotermitidae
5.5%
Termopsidae
4.4%
Passalidae
3.3%
Hydrophilidae
2.2%
Tenebrionidae
1.1%
Hodotermitidae
1.1%
Drosophilidae
1.1%
Taxonomy
Archaea
0
Bacteria
324
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 2 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 3 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 4 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 5 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 6 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 7 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 8 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 9 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 10 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 11 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 12 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 13 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 20 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 21 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 22 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 23 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 24 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 38 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 39 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 40 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 51 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 52 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 53 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 54 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 55 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 56 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 57 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 58 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 59 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 60 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 61 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 62 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 66 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 67 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 68 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 69 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 70 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 71 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 72 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 73 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 74 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 75 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 76 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 77 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 78 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 79 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 80 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 81 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 82 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 83 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 84 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 85 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 86 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 87 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 88 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 89 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 90 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 91 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_175063 | 3300042611 | Bacteria | 1451 |
| 2 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 3 | Ga0466733_137741 | 3300042659 | Bacteria | 1247 |
| 4 | Ga0466707_299719 | 3300042601 | Bacteria | 9318 |
| 5 | Ga0466707_352441 | 3300042601 | Bacteria | 14035 |
| 6 | Ga0466713_086755 | 3300042602 | Bacteria | 10887 |
| 7 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 8 | Ga0466713_135469 | 3300042602 | Bacteria | 58117 |
| 9 | Ga0466719_574265 | 3300042606 | Bacteria | 1071 |
| 10 | Ga0466692_126172 | 3300042591 | Bacteria | 2655 |
| 11 | Ga0466691_046533 | 3300042593 | Bacteria | 8932 |
| 12 | Ga0466691_217171 | 3300042593 | Bacteria | 3753 |
| 13 | Ga0466695_274109 | 3300042595 | Bacteria | 2278 |
| 14 | Ga0466696_001311 | 3300042596 | Bacteria | 2552 |
| 15 | Ga0466711_113654 | 3300042615 | Bacteria | 7927 |
| 16 | Ga0466726_366063 | 3300042619 | Bacteria | 4466 |
| 17 | Ga0466734_066905 | 3300042623 | Bacteria | 1374 |
| 18 | Ga0466703_237244 | 3300042636 | Bacteria | 5356 |
| 19 | Ga0466703_425730 | 3300042636 | Bacteria | 1249 |
| 20 | Ga0466704_059052 | 3300042643 | Bacteria | 32672 |
| 21 | Ga0466709_082147 | 3300042648 | Bacteria | 2736 |
| 22 | Ga0466708_160923 | 3300042652 | Bacteria | 24813 |
| 23 | Ga0466727_081347 | 3300042655 | Bacteria | 65648 |
| 24 | Ga0466727_203810 | 3300042655 | Bacteria | 6610 |
| 25 | Ga0123357_10155660 | 3300009784 | Bacteria | 2758 |
| 26 | Ga0123354_10001726 | 3300010882 | Bacteria | 27419 |
| 27 | Ga0123354_10160604 | 3300010882 | Bacteria | 2670 |
| 28 | JGI24702J35022_10000539 | 3300002462 | Bacteria | 22829 |
| 29 | Ga0068302_10338933 | 3300005071 | Bacteria | 2772 |
| 30 | Ga0068305_10059201 | 3300005083 | Bacteria | 10856 |
| 31 | Ga0466701_052963 | 3300042598 | Bacteria | 41459 |
| 32 | Ga0466707_339101 | 3300042601 | Bacteria | 3267 |
| 33 | Ga0466707_378745 | 3300042601 | Bacteria | 1351 |
| 34 | Ga0466713_025329 | 3300042602 | Bacteria | 1061 |
| 35 | Ga0466713_112154 | 3300042602 | Bacteria | 38459 |
| 36 | Ga0466716_380648 | 3300042605 | Bacteria | 32232 |
| 37 | Ga0466690_040815 | 3300042590 | Bacteria | 27317 |
| 38 | Ga0466691_107533 | 3300042593 | Bacteria | 41472 |
| 39 | Ga0466695_402172 | 3300042595 | Bacteria | 1795 |
| 40 | Ga0466715_147874 | 3300042616 | Bacteria | 8029 |
| 41 | Ga0466715_203271 | 3300042616 | Bacteria | 2659 |
| 42 | Ga0466715_626885 | 3300042616 | Bacteria | 3989 |
| 43 | Ga0466726_219634 | 3300042619 | Bacteria | 1216 |
| 44 | Ga0466735_012727 | 3300042624 | Bacteria | 14766 |
| 45 | Ga0466703_118424 | 3300042636 | Bacteria | 1736 |
| 46 | Ga0466703_185216 | 3300042636 | Bacteria | 18948 |
| 47 | Ga0466703_319105 | 3300042636 | Bacteria | 1344 |
| 48 | Ga0466727_116157 | 3300042655 | Bacteria | 3296 |
| 49 | Ga0123357_10021045 | 3300009784 | Bacteria | 8727 |
| 50 | Ga0123357_10098953 | 3300009784 | Bacteria | 3768 |
| 51 | Ga0123357_10184018 | 3300009784 | Bacteria | 2429 |
| 52 | Ga0123356_10004714 | 3300010049 | Bacteria | 14049 |
| 53 | Ga0123356_10059287 | 3300010049 | Bacteria | 3570 |
| 54 | Ga0123356_10572881 | 3300010049 | Bacteria | 1292 |
| 55 | Ga0123354_10117150 | 3300010882 | Bacteria | 3469 |
| 56 | JGI24702J35022_10068454 | 3300002462 | Bacteria | 1908 |
| 57 | JGI24702J35022_10106173 | 3300002462 | Bacteria | 1541 |
| 58 | Ga0068305_10274752 | 3300005083 | Bacteria | 3233 |
| 59 | Ga0466705_036049 | 3300042612 | Bacteria | 5946 |
| 60 | Ga0466705_166179 | 3300042612 | Bacteria | 4739 |
| 61 | Ga0466701_058387 | 3300042598 | Bacteria | 1464 |
| 62 | Ga0466707_346613 | 3300042601 | Bacteria | 17564 |
| 63 | Ga0466713_019678 | 3300042602 | Bacteria | 71467 |
| 64 | Ga0466719_025667 | 3300042606 | Bacteria | 13428 |
| 65 | Ga0466719_477481 | 3300042606 | Bacteria | 2797 |
| 66 | Ga0466720_163111 | 3300042607 | Bacteria | 1673 |
| 67 | Ga0466690_424102 | 3300042590 | Bacteria | 10143 |
| 68 | Ga0466692_027186 | 3300042591 | Bacteria | 1697 |
| 69 | Ga0466692_041865 | 3300042591 | Bacteria | 9909 |
| 70 | Ga0466692_152386 | 3300042591 | Bacteria | 51187 |
| 71 | Ga0466693_042309 | 3300042592 | Bacteria | 3596 |
| 72 | Ga0466694_372429 | 3300042594 | Bacteria | 1219 |
| 73 | Ga0466696_072495 | 3300042596 | Unclassified | 2385 |
| 74 | Ga0466696_127052 | 3300042596 | Bacteria | 5336 |
| 75 | Ga0466705_521960 | 3300042612 | Bacteria | 5900 |
| 76 | Ga0466715_044536 | 3300042616 | Unclassified | 2483 |
| 77 | Ga0466723_143194 | 3300042618 | Bacteria | 14578 |
| 78 | Ga0466726_334054 | 3300042619 | Bacteria | 17493 |
| 79 | Ga0466728_017361 | 3300042620 | Bacteria | 2052 |
| 80 | Ga0466728_030310 | 3300042620 | Bacteria | 17191 |
| 81 | Ga0466735_114041 | 3300042624 | Bacteria | 10723 |
| 82 | Ga0466735_129552 | 3300042624 | Bacteria | 2282 |
| 83 | Ga0466735_137164 | 3300042624 | Bacteria | 3970 |
| 84 | Ga0466735_143019 | 3300042624 | Bacteria | 1630 |
| 85 | Ga0466735_151296 | 3300042624 | Bacteria | 1396 |
| 86 | Ga0466703_417423 | 3300042636 | Bacteria | 5076 |
| 87 | Ga0466704_303031 | 3300042643 | Bacteria | 21934 |
| 88 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 89 | Ga0466709_313275 | 3300042648 | Bacteria | 6087 |
| 90 | Ga0123356_10343972 | 3300010049 | Bacteria | 1613 |
| 91 | Ga0123354_10001526 | 3300010882 | Bacteria | 28355 |
| 92 | Ga0123354_10209979 | 3300010882 | Bacteria | 2108 |
| 93 | 2227473792 | 2225789004 | Bacteria | 4750 |
| 94 | IMNBL1DRAFT_c0002186 | 3300000062 | Bacteria | 13793 |
| 95 | IMNBL1DRAFT_c0003398 | 3300000062 | Bacteria | 10280 |
| 96 | JGI24702J35022_10008050 | 3300002462 | Bacteria | 6000 |
| 97 | JGI24699J35502_10973069 | 3300002509 | Bacteria | 1243 |
| 98 | JGI24699J35502_11133379 | 3300002509 | Bacteria | 10198 |
| 99 | Ga0466705_264813 | 3300042612 | Bacteria | 21427 |
| 100 | Ga0466732_321002 | 3300042656 | Bacteria | 1079 |
| 101 | Ga0466706_029270 | 3300042599 | Bacteria | 7556 |
| 102 | Ga0466700_252013 | 3300042600 | Bacteria | 17693 |
| 103 | Ga0466707_327825 | 3300042601 | Bacteria | 8127 |
| 104 | Ga0466713_003449 | 3300042602 | Bacteria | 2283 |
| 105 | Ga0466713_005635 | 3300042602 | Bacteria | 57913 |
| 106 | Ga0466713_080670 | 3300042602 | Bacteria | 1582 |
| 107 | Ga0466714_053998 | 3300042603 | Bacteria | 38880 |
| 108 | Ga0466714_147551 | 3300042603 | Bacteria | 2003 |
| 109 | Ga0466719_227098 | 3300042606 | Bacteria | 4223 |
| 110 | Ga0466722_207089 | 3300042609 | Bacteria | 6629 |
| 111 | Ga0466722_243742 | 3300042609 | Bacteria | 1419 |
| 112 | Ga0466657_310765 | 3300042582 | Bacteria | 17179 |
| 113 | Ga0466690_094019 | 3300042590 | Bacteria | 12956 |
| 114 | Ga0466690_296510 | 3300042590 | Bacteria | 22089 |
| 115 | Ga0466693_136322 | 3300042592 | Bacteria | 1149 |
| 116 | Ga0466696_225672 | 3300042596 | Bacteria | 3867 |
| 117 | Ga0466696_226543 | 3300042596 | Bacteria | 6178 |
| 118 | Ga0466715_007439 | 3300042616 | Bacteria | 21473 |
| 119 | Ga0466715_135947 | 3300042616 | Bacteria | 7031 |
| 120 | Ga0466723_137240 | 3300042618 | Bacteria | 37694 |
| 121 | Ga0466723_199561 | 3300042618 | Bacteria | 9162 |
| 122 | Ga0466726_231922 | 3300042619 | Bacteria | 4030 |
| 123 | Ga0466728_059237 | 3300042620 | Bacteria | 41009 |
| 124 | Ga0466729_082744 | 3300042621 | Bacteria | 9963 |
| 125 | Ga0466734_166105 | 3300042623 | Bacteria | 1467 |
| 126 | Ga0466703_252044 | 3300042636 | Bacteria | 6802 |
| 127 | Ga0466703_331732 | 3300042636 | Bacteria | 9966 |
| 128 | Ga0466703_349522 | 3300042636 | Bacteria | 7341 |
| 129 | Ga0466704_469167 | 3300042643 | Bacteria | 9925 |
| 130 | Ga0466704_494994 | 3300042643 | Bacteria | 12479 |
| 131 | Ga0466704_498990 | 3300042643 | Bacteria | 20830 |
| 132 | Ga0466708_062555 | 3300042652 | Bacteria | 4191 |
| 133 | Ga0466727_052174 | 3300042655 | Bacteria | 9013 |
| 134 | Ga0466727_103661 | 3300042655 | Bacteria | 10179 |
| 135 | Ga0466727_215312 | 3300042655 | Bacteria | 4563 |
| 136 | Ga0466727_269625 | 3300042655 | Bacteria | 6609 |
| 137 | Ga0123354_10000543 | 3300010882 | Bacteria | 38707 |
| 138 | Ga0123354_10046789 | 3300010882 | Bacteria | 6604 |
| 139 | 2227076065 | 2225789003 | Bacteria | 2258 |
| 140 | 2227266900 | 2225789004 | Bacteria | 6955 |
| 141 | 2227349130 | 2225789004 | Bacteria | 1144 |
| 142 | 2227593534 | 2225789004 | Unclassified | 2400 |
| 143 | IMNBL1DRAFT_c0005750 | 3300000062 | Bacteria | 6982 |
| 144 | JGI24702J35022_10314063 | 3300002462 | Bacteria | 928 |
| 145 | JGI24699J35502_11134225 | 3300002509 | Bacteria | 74107 |
| 146 | Ga0068302_10041915 | 3300005071 | Bacteria | 10017 |
| 147 | Ga0068302_10257197 | 3300005071 | Bacteria | 2986 |
| 148 | Ga0466697_186819 | 3300042611 | Bacteria | 2561 |
| 149 | Ga0466705_025964 | 3300042612 | Bacteria | 7897 |
| 150 | Ga0466705_194768 | 3300042612 | Bacteria | 2093 |
| 151 | Ga0466706_078249 | 3300042599 | Bacteria | 49927 |
| 152 | Ga0466700_453401 | 3300042600 | Bacteria | 2337 |
| 153 | Ga0466707_314075 | 3300042601 | Bacteria | 5437 |
| 154 | Ga0466707_332894 | 3300042601 | Bacteria | 75459 |
| 155 | Ga0466713_064625 | 3300042602 | Bacteria | 3574 |
| 156 | Ga0466713_080837 | 3300042602 | Bacteria | 14389 |
| 157 | Ga0466716_130953 | 3300042605 | Bacteria | 17167 |
| 158 | Ga0466716_226239 | 3300042605 | Bacteria | 3363 |
| 159 | Ga0466719_093397 | 3300042606 | Bacteria | 6223 |
| 160 | Ga0466719_195991 | 3300042606 | Bacteria | 10092 |
| 161 | Ga0466722_259640 | 3300042609 | Bacteria | 4594 |
| 162 | Ga0466722_268903 | 3300042609 | Bacteria | 23415 |
| 163 | Ga0466690_033685 | 3300042590 | Bacteria | 49521 |
| 164 | Ga0466690_264235 | 3300042590 | Bacteria | 3772 |
| 165 | Ga0466692_008378 | 3300042591 | Bacteria | 4108 |
| 166 | Ga0466692_113590 | 3300042591 | Bacteria | 22636 |
| 167 | Ga0466691_101253 | 3300042593 | Bacteria | 27575 |
| 168 | Ga0466696_281316 | 3300042596 | Bacteria | 5761 |
| 169 | Ga0466696_327367 | 3300042596 | Bacteria | 2777 |
| 170 | Ga0466705_389445 | 3300042612 | Bacteria | 2555 |
| 171 | Ga0466715_063666 | 3300042616 | Bacteria | 17036 |
| 172 | Ga0466715_286522 | 3300042616 | Bacteria | 11961 |
| 173 | Ga0466735_037112 | 3300042624 | Bacteria | 2750 |
| 174 | Ga0466703_158835 | 3300042636 | Bacteria | 3853 |
| 175 | Ga0466703_208988 | 3300042636 | Bacteria | 1971 |
| 176 | Ga0466704_145200 | 3300042643 | Unclassified | 2363 |
| 177 | Ga0466704_522895 | 3300042643 | Bacteria | 2662 |
| 178 | Ga0466704_554901 | 3300042643 | Bacteria | 24622 |
| 179 | Ga0466708_183345 | 3300042652 | Bacteria | 8280 |
| 180 | Ga0466727_041884 | 3300042655 | Bacteria | 4899 |
| 181 | Ga0123353_10180813 | 3300010167 | Bacteria | 3339 |
| 182 | Ga0123354_10001044 | 3300010882 | Bacteria | 31803 |
| 183 | Ga0123354_10055072 | 3300010882 | Unclassified | 5957 |
| 184 | 2227561854 | 2225789004 | Bacteria | 2714 |
| 185 | IMNBL1DRAFT_c0000136 | 3300000062 | Bacteria | 65757 |
| 186 | IMNBL1DRAFT_c0012924 | 3300000062 | Bacteria | 3783 |
| 187 | Ga0068302_10149867 | 3300005071 | Bacteria | 6189 |
| 188 | Ga0466705_297878 | 3300042612 | Bacteria | 9895 |
| 189 | Ga0466733_043118 | 3300042659 | Bacteria | 7307 |
| 190 | Ga0466733_098295 | 3300042659 | Bacteria | 47070 |
| 191 | Ga0466733_113919 | 3300042659 | Bacteria | 25761 |
| 192 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 193 | Ga0466701_090755 | 3300042598 | Bacteria | 5310 |
| 194 | Ga0466706_141970 | 3300042599 | Bacteria | 2919 |
| 195 | Ga0466713_028944 | 3300042602 | Bacteria | 23612 |
| 196 | Ga0466713_051118 | 3300042602 | Bacteria | 11710 |
| 197 | Ga0466713_091934 | 3300042602 | Bacteria | 1291 |
| 198 | Ga0466713_099542 | 3300042602 | Bacteria | 3708 |
| 199 | Ga0466713_123740 | 3300042602 | Bacteria | 15528 |
| 200 | Ga0466719_276126 | 3300042606 | Bacteria | 5037 |
| 201 | Ga0466722_190088 | 3300042609 | Bacteria | 7769 |
| 202 | Ga0466698_152946 | 3300042610 | Bacteria | 1605 |
| 203 | Ga0466692_105341 | 3300042591 | Bacteria | 69128 |
| 204 | Ga0466696_214952 | 3300042596 | Bacteria | 1806 |
| 205 | Ga0466715_039775 | 3300042616 | Bacteria | 14144 |
| 206 | Ga0466715_280548 | 3300042616 | Bacteria | 14581 |
| 207 | Ga0466723_067878 | 3300042618 | Bacteria | 17474 |
| 208 | Ga0466728_128512 | 3300042620 | Bacteria | 23920 |
| 209 | Ga0466729_230839 | 3300042621 | Bacteria | 12304 |
| 210 | Ga0466735_053625 | 3300042624 | Bacteria | 2273 |
| 211 | Ga0466735_192873 | 3300042624 | Bacteria | 2766 |
| 212 | Ga0466730_048536 | 3300042625 | Bacteria | 4808 |
| 213 | Ga0466703_008613 | 3300042636 | Bacteria | 9193 |
| 214 | Ga0466703_148070 | 3300042636 | Bacteria | 13838 |
| 215 | Ga0466704_179826 | 3300042643 | Bacteria | 45154 |
| 216 | Ga0466704_303882 | 3300042643 | Bacteria | 3074 |
| 217 | Ga0466725_323363 | 3300042654 | Bacteria | 1344 |
| 218 | Ga0466727_039648 | 3300042655 | Bacteria | 3637 |
| 219 | Ga0123357_10088502 | 3300009784 | Bacteria | 4046 |
| 220 | JGI24702J35022_10257373 | 3300002462 | Bacteria | 1017 |
| 221 | Ga0068305_10006769 | 3300005083 | Bacteria | 39612 |
| 222 | Ga0466733_166481 | 3300042659 | Bacteria | 10782 |
| 223 | Ga0466701_083828 | 3300042598 | Bacteria | 7767 |
| 224 | Ga0466700_023622 | 3300042600 | Bacteria | 1542 |
| 225 | Ga0466700_221114 | 3300042600 | Bacteria | 50828 |
| 226 | Ga0466707_004523 | 3300042601 | Bacteria | 18434 |
| 227 | Ga0466713_082970 | 3300042602 | Bacteria | 27945 |
| 228 | Ga0466716_013462 | 3300042605 | Bacteria | 13962 |
| 229 | Ga0466716_017763 | 3300042605 | Bacteria | 18991 |
| 230 | Ga0466722_184350 | 3300042609 | Bacteria | 15101 |
| 231 | Ga0466691_209629 | 3300042593 | Bacteria | 1450 |
| 232 | Ga0466696_366108 | 3300042596 | Bacteria | 2874 |
| 233 | Ga0466710_264094 | 3300042613 | Bacteria | 2351 |
| 234 | Ga0466710_341617 | 3300042613 | Bacteria | 1976 |
| 235 | Ga0466711_046393 | 3300042615 | Bacteria | 4926 |
| 236 | Ga0466711_374284 | 3300042615 | Bacteria | 8076 |
| 237 | Ga0466715_289909 | 3300042616 | Unclassified | 1502 |
| 238 | Ga0466715_567865 | 3300042616 | Bacteria | 6645 |
| 239 | Ga0466723_025239 | 3300042618 | Bacteria | 67003 |
| 240 | Ga0466723_146997 | 3300042618 | Bacteria | 23442 |
| 241 | Ga0466728_195400 | 3300042620 | Bacteria | 87109 |
| 242 | Ga0466729_250146 | 3300042621 | Bacteria | 4211 |
| 243 | Ga0466735_005463 | 3300042624 | Bacteria | 11774 |
| 244 | Ga0466735_110024 | 3300042624 | Bacteria | 5631 |
| 245 | Ga0466703_164874 | 3300042636 | Bacteria | 12114 |
| 246 | Ga0466703_387879 | 3300042636 | Bacteria | 3152 |
| 247 | Ga0466704_144657 | 3300042643 | Bacteria | 9526 |
| 248 | Ga0466708_151348 | 3300042652 | Bacteria | 14015 |
| 249 | Ga0466727_161583 | 3300042655 | Unclassified | 1520 |
| 250 | Ga0123357_10571245 | 3300009784 | Bacteria | 888 |
| 251 | 2227177487 | 2225789004 | Bacteria | 1504 |
| 252 | 2227303036 | 2225789004 | Bacteria | 6581 |
| 253 | IMNBL1DRAFT_c0001849 | 3300000062 | Bacteria | 15407 |
| 254 | IMNBL1DRAFT_c0005391 | 3300000062 | Bacteria | 7328 |
| 255 | IMNBL1DRAFT_c0010555 | 3300000062 | Bacteria | 4403 |
| 256 | JGI24702J35022_10179794 | 3300002462 | Bacteria | 1201 |
| 257 | JGI24705J35276_12232634 | 3300002504 | Bacteria | 4418 |
| 258 | Ga0104048_1015744 | 3300007143 | Bacteria | 1655 |
| 259 | Ga0123357_10000452 | 3300009784 | Bacteria | 39673 |
| 260 | Ga0123357_10002040 | 3300009784 | Bacteria | 22155 |
| 261 | Ga0466733_157229 | 3300042659 | Bacteria | 7185 |
| 262 | Ga0466707_045014 | 3300042601 | Unclassified | 2342 |
| 263 | Ga0466713_031645 | 3300042602 | Bacteria | 3535 |
| 264 | Ga0466716_116221 | 3300042605 | Bacteria | 7452 |
| 265 | Ga0466716_322202 | 3300042605 | Bacteria | 12338 |
| 266 | Ga0466719_452850 | 3300042606 | Bacteria | 4270 |
| 267 | Ga0466719_518759 | 3300042606 | Bacteria | 2126 |
| 268 | Ga0466722_098957 | 3300042609 | Bacteria | 2848 |
| 269 | Ga0466722_137523 | 3300042609 | Bacteria | 15118 |
| 270 | Ga0466722_153501 | 3300042609 | Bacteria | 1558 |
| 271 | Ga0466690_386085 | 3300042590 | Bacteria | 20488 |
| 272 | Ga0466692_109163 | 3300042591 | Bacteria | 123520 |
| 273 | Ga0466694_091566 | 3300042594 | Bacteria | 4393 |
| 274 | Ga0466696_134020 | 3300042596 | Bacteria | 25576 |
| 275 | Ga0466696_242324 | 3300042596 | Bacteria | 39108 |
| 276 | Ga0466711_475772 | 3300042615 | Bacteria | 3583 |
| 277 | Ga0466715_427106 | 3300042616 | Bacteria | 52396 |
| 278 | Ga0466726_464852 | 3300042619 | Unclassified | 7107 |
| 279 | Ga0466728_239301 | 3300042620 | Bacteria | 2912 |
| 280 | Ga0466729_253528 | 3300042621 | Bacteria | 21930 |
| 281 | Ga0466735_111928 | 3300042624 | Bacteria | 1037 |
| 282 | Ga0466735_155313 | 3300042624 | Bacteria | 1278 |
| 283 | Ga0466735_169605 | 3300042624 | Bacteria | 1699 |
| 284 | Ga0466703_246458 | 3300042636 | Bacteria | 1247 |
| 285 | Ga0466703_261320 | 3300042636 | Bacteria | 41798 |
| 286 | Ga0466703_425475 | 3300042636 | Bacteria | 3975 |
| 287 | Ga0466704_452521 | 3300042643 | Bacteria | 8300 |
| 288 | Ga0466709_407398 | 3300042648 | Bacteria | 7446 |
| 289 | Ga0123357_10123506 | 3300009784 | Bacteria | 3251 |
| 290 | Ga0123356_10191031 | 3300010049 | Bacteria | 2079 |
| 291 | Ga0123353_10123163 | 3300010167 | Bacteria | 4167 |
| 292 | Ga0123353_10808619 | 3300010167 | Bacteria | 1293 |
| 293 | Ga0123353_11218954 | 3300010167 | Bacteria | 985 |
| 294 | Ga0123354_10057590 | 3300010882 | Unclassified | 5785 |
| 295 | IMNBL1DRAFT_c0006826 | 3300000062 | Bacteria | 6146 |
| 296 | JGI24702J35022_10055131 | 3300002462 | Bacteria | 2121 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03819 | MazG | MazG nucleotide pyrophosphohydrolase domain | 33 | 106 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.