Protein Family IF05476
Metagenome
Isolate
269
Members
194
Samples
108
Scaffolds
597.1
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_047018|Ga0466701_047018_35464_37365
- Length
- 633 aa
- Sequence
- MLHDVAEQICVIEDTHRIYEDYKSGLTSIEETDMPQYKAPLRDMHFVLHELLNAEEHYAKLPAFQETVSRELIDQYLEAGADFCENELSPLNQIGDREGCKWDDGVVTTPTGFKAAYDKYVELGFPSLSVPEEHGGQGLPGSLATAISEMVGAANWAWGMYPGLSHGAVRTIEHHGSAEQKATYLPKLVSGEWTGTMCLTESHAGSDLGIIRSKAEPQADGSYAISGEKIFISAGEHDMAENIVHIVLARLPGAPKGTKGISLFIVPKFNVNADGSIADRNSVRCGSIEHKMGIHGNATCVINFDNAKGFLIGPENRGLHAMFTFMNTARIGTAVQGLTASESSFQGALAYAKDRLAMRSLSGPKSPEKEADPIIVHPAVRNMLMTQKAFAEGGRALVYFLSQYADVVEQGVTEEDRKFADNILSLLTPIAKAFLTETGSESAKHGVQVFGGHGFISEHGMEQIVRDTRISCLYEGTTEIQALDLLGRKVLGTQGAMLKDFTKIIHKFAEANKDNADLKEFVEPLAALNKEWGDLTMQIGMKAMQNPDEVGAAAVDYLYFSGYVTLAFLWARMALVAQQKLAEGSTETGFYNAKIKTARFYFKKILPRVRSHVDVIAGGLDPLMSLDAEDFAF
Sample Types
Isolate
59.9%
Metagenome
40.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
42.6%
Elmidae
12.2%
Formicidae
7.4%
Termitidae
6.9%
Unclassified
6.4%
Culicidae
4.8%
Curculionidae
4.8%
Armadillidiidae
3.7%
Drosophilidae
2.1%
Nephropidae
1.1%
Hydrophilidae
1.1%
Largidae
1.1%
Kalotermitidae
1.1%
Berytidae
1.1%
Alydidae
1.1%
Passalidae
0.5%
Tenebrionidae
0.5%
Trigoniulidae
0.5%
Pediculidae
0.5%
Noctuidae
0.5%
Taxonomy
Archaea
0
Bacteria
246
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 2 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 3 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 4 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 5 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 6 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 7 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 8 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 9 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 10 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 16 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 17 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 18 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 19 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 20 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 21 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 22 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 23 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 24 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 25 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 26 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 27 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 28 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 29 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 30 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 31 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 32 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 33 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 37 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 38 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 39 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 40 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 41 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 42 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 43 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 44 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 45 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 46 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 47 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 48 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 49 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 50 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 51 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 52 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 53 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 54 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 55 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 56 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 57 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 58 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 59 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 60 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 61 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 62 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 63 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 64 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 65 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 66 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 67 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 68 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 69 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 70 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 71 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 72 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 73 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 74 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 75 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 76 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 77 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 78 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 79 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 80 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 81 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 82 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 83 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 84 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 85 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 86 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 87 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 88 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 89 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 90 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 91 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 92 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 93 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 94 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 95 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 96 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 97 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 98 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 99 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 100 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 101 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 102 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 103 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 104 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 105 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 106 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 107 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 108 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 109 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 110 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 111 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 112 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 113 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 114 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 115 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 116 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 117 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 118 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 119 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 120 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 121 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 122 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 123 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 124 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 125 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 126 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 127 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 128 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 129 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 130 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 131 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 132 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 133 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 134 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 135 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 136 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 137 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 138 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 139 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 140 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 141 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 142 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 143 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 144 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 145 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 146 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 147 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 148 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 149 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 150 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 151 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 152 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 153 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 154 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 155 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 156 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 157 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 158 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 159 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 160 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 161 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 162 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 163 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 164 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 165 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 166 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 167 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 168 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 169 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 170 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 171 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 172 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 173 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 174 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 175 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 176 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 177 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 178 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 179 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 180 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 181 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 182 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 183 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 184 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 185 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 186 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 187 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 188 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 189 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 190 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 191 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 192 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 193 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 194 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562376_1399 | 3300056857 | Bacteria | 34206 |
| 2 | Ga0466710_385263 | 3300042613 | Bacteria | 8042 |
| 3 | Ga0160470_102000 | 3300012813 | Bacteria | 4225 |
| 4 | Ga0466701_028810 | 3300042598 | Unclassified | 41404 |
| 5 | Ga0466730_086547 | 3300042625 | Bacteria | 310448 |
| 6 | Ga0466709_113424 | 3300042648 | Bacteria | 29718 |
| 7 | DPO_contig07790 | 2032320009 | Unclassified | 66485 |
| 8 | SPBB_contig09583 | 2044078006 | Bacteria | 14450 |
| 9 | CVPL005W_1000626 | 3300002934 | Bacteria | 14546 |
| 10 | Ga0160469_100072 | 3300012824 | Bacteria | 169548 |
| 11 | Ga0466701_012403 | 3300042598 | Unclassified | 55784 |
| 12 | Ga0466701_047018 | 3300042598 | Bacteria | 175250 |
| 13 | Ga0466725_083798 | 3300042654 | Bacteria | 7096 |
| 14 | DPO_contig06136 | 2032320009 | Unclassified | 20854 |
| 15 | CVPL010W_10000555 | 3300002931 | Bacteria | 40973 |
| 16 | Ga0102734_1001878 | 3300007129 | Bacteria | 5091 |
| 17 | Ga0102734_1003049 | 3300007129 | Bacteria | 7428 |
| 18 | Ga0103260_1003201 | 3300007139 | Bacteria | 2670 |
| 19 | Ga0102738_1000823 | 3300007141 | Bacteria | 4903 |
| 20 | Ga0102737_1000008 | 3300007142 | Bacteria | 132850 |
| 21 | Ga0102737_1005699 | 3300007142 | Bacteria | 2448 |
| 22 | Ga0104019_1029534 | 3300007150 | Bacteria | 3202 |
| 23 | Ga0123354_10001603 | 3300010882 | Bacteria | 27952 |
| 24 | Ga0160454_100218 | 3300012798 | Bacteria | 59432 |
| 25 | Ga0160466_101571 | 3300012809 | Bacteria | 5871 |
| 26 | Ga0160470_103880 | 3300012813 | Unclassified | 2262 |
| 27 | Ga0160431_100907 | 3300012828 | Bacteria | 9483 |
| 28 | Ga0160460_100108 | 3300012845 | Bacteria | 114707 |
| 29 | Ga0466701_047412 | 3300042598 | Bacteria | 1985 |
| 30 | Ga0466731_128190 | 3300042622 | Bacteria | 10323 |
| 31 | Ga0466709_241557 | 3300042648 | Bacteria | 20578 |
| 32 | Ga0466724_65694 | 3300042649 | Bacteria | 7817 |
| 33 | DPOL_contig16517 | 2035918003 | Unclassified | 11988 |
| 34 | CVPL005L_10012353 | 3300002938 | Unclassified | 6386 |
| 35 | Ga0102735_1001398 | 3300007080 | Bacteria | 4153 |
| 36 | Ga0103260_1000011 | 3300007139 | Bacteria | 101836 |
| 37 | Ga0102740_1000001 | 3300007140 | Bacteria | 144366 |
| 38 | Ga0466705_445813 | 3300042612 | Bacteria | 12172 |
| 39 | Ga0160470_100076 | 3300012813 | Bacteria | 133554 |
| 40 | Ga0160446_100071 | 3300012835 | Bacteria | 101245 |
| 41 | Ga0160447_100039 | 3300012849 | Bacteria | 163675 |
| 42 | Ga0160457_1000004 | 3300012858 | Bacteria | 638897 |
| 43 | Ga0466730_037750 | 3300042625 | Bacteria | 29585 |
| 44 | Ga0466730_048244 | 3300042625 | Bacteria | 135195 |
| 45 | Ga0466709_020695 | 3300042648 | Bacteria | 11525 |
| 46 | Ga0466724_36778 | 3300042649 | Bacteria | 2511 |
| 47 | Ga0466724_55041 | 3300042649 | Bacteria | 15031 |
| 48 | Ga0466724_66004 | 3300042649 | Bacteria | 70192 |
| 49 | Ga0068305_10475712 | 3300005083 | Bacteria | 2149 |
| 50 | Ga0104019_1003903 | 3300007150 | Bacteria | 5804 |
| 51 | Ga0105553_1000234 | 3300007767 | Bacteria | 5977 |
| 52 | Ga0160441_101172 | 3300012825 | Bacteria | 9796 |
| 53 | Ga0466701_039976 | 3300042598 | Bacteria | 327114 |
| 54 | Ga0466717_239141 | 3300042604 | Unclassified | 5149 |
| 55 | Ga0466730_062358 | 3300042625 | Bacteria | 2779 |
| 56 | Ga0466724_38768 | 3300042649 | Bacteria | 155416 |
| 57 | Ga0466725_086964 | 3300042654 | Bacteria | 2709 |
| 58 | IMNBGM34_c000001 | 3300000036 | Bacteria | 85540 |
| 59 | CVPL010W_10016998 | 3300002931 | Bacteria | 5002 |
| 60 | Ga0102736_1000033 | 3300007052 | Bacteria | 60059 |
| 61 | Ga0102734_1000002 | 3300007129 | Bacteria | 106034 |
| 62 | Ga0160440_100118 | 3300012815 | Unclassified | 79596 |
| 63 | Ga0160467_100152 | 3300012829 | Bacteria | 97582 |
| 64 | Ga0160445_100613 | 3300012847 | Bacteria | 15413 |
| 65 | Ga0160443_102843 | 3300012848 | Bacteria | 3441 |
| 66 | Ga0466657_135368 | 3300042582 | Bacteria | 11717 |
| 67 | Ga0466693_418660 | 3300042592 | Bacteria | 6766 |
| 68 | Ga0466701_020904 | 3300042598 | Bacteria | 560833 |
| 69 | Ga0466701_045249 | 3300042598 | Unclassified | 102024 |
| 70 | Ga0466701_064891 | 3300042598 | Bacteria | 8625 |
| 71 | Ga0466734_075113 | 3300042623 | Bacteria | 12658 |
| 72 | Ga0466730_082534 | 3300042625 | Unclassified | 80415 |
| 73 | Ga0466730_097729 | 3300042625 | Bacteria | 14162 |
| 74 | Ga0466724_24697 | 3300042649 | Unclassified | 3458 |
| 75 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 76 | SPBB_contig11369 | 2044078006 | Bacteria | 48467 |
| 77 | Meta3P_1002420 | 3300002464 | Bacteria | 6239 |
| 78 | Ga0102740_1000761 | 3300007140 | Bacteria | 8732 |
| 79 | Ga0102740_1005228 | 3300007140 | Unclassified | 4677 |
| 80 | Ga0466697_240824 | 3300042611 | Bacteria | 8844 |
| 81 | Ga0160455_100785 | 3300012837 | Unclassified | 12664 |
| 82 | Ga0160444_100233 | 3300012841 | Unclassified | 46508 |
| 83 | Ga0160430_103286 | 3300012852 | Bacteria | 4567 |
| 84 | Ga0466734_004492 | 3300042623 | Bacteria | 8816 |
| 85 | Ga0466730_007804 | 3300042625 | Bacteria | 147947 |
| 86 | Ga0466730_054513 | 3300042625 | Bacteria | 33486 |
| 87 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 88 | JGI24705J35276_12235862 | 3300002504 | Unclassified | 7074 |
| 89 | CVPL010W_10018300 | 3300002931 | Unclassified | 4402 |
| 90 | Ga0103263_100049 | 3300007042 | Unclassified | 28345 |
| 91 | Ga0102736_1000232 | 3300007052 | Bacteria | 12624 |
| 92 | Ga0104051_1101755 | 3300007078 | Bacteria | 3694 |
| 93 | Ga0103261_1000035 | 3300007083 | Bacteria | 82381 |
| 94 | Ga0102739_1000040 | 3300007095 | Bacteria | 64022 |
| 95 | Ga0102738_1000059 | 3300007141 | Bacteria | 45781 |
| 96 | Ga0102737_1002868 | 3300007142 | Bacteria | 4116 |
| 97 | Ga0160454_100383 | 3300012798 | Bacteria | 24571 |
| 98 | Ga0160471_100110 | 3300012812 | Bacteria | 42140 |
| 99 | Ga0160471_100513 | 3300012812 | Unclassified | 10555 |
| 100 | Ga0160470_100128 | 3300012813 | Bacteria | 78520 |
| 101 | Ga0160459_104133 | 3300012831 | Unclassified | 2006 |
| 102 | Ga0160430_102245 | 3300012852 | Unclassified | 6260 |
| 103 | Ga0466657_049814 | 3300042582 | Bacteria | 6412 |
| 104 | Ga0466701_089314 | 3300042598 | Bacteria | 182031 |
| 105 | Ga0466734_103955 | 3300042623 | Bacteria | 5899 |
| 106 | Ga0466730_099305 | 3300042625 | Unclassified | 25420 |
| 107 | Ga0466724_09352 | 3300042649 | Bacteria | 54615 |
| 108 | Ga0103265_1000340 | 3300007068 | Unclassified | 12056 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12418 | AcylCoA_DH_N | Acyl-CoA dehydrogenase N terminal | 36 | 66 | 0.98 |
| PF12806 | Acyl-CoA_dh_C | Acetyl-CoA dehydrogenase C-terminal like | 501 | 627 | 0.96 |
| PF00441 | Acyl-CoA_dh_1 | Acyl-CoA dehydrogenase, C-terminal domain | 316 | 484 | 0.92 |
| PF02770 | Acyl-CoA_dh_M | Acyl-CoA dehydrogenase, middle domain | 197 | 306 | 0.82 |
| PF02771 | Acyl-CoA_dh_N | Acyl-CoA dehydrogenase, N-terminal domain | 78 | 192 | 0.82 |
| PF22924 | ACOX_C_alpha1 | Acyl-CoA oxidase, C-alpha1 domain | 348 | 480 | 0.77 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00441 | GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.