Protein Family IF05370
Metagenome
Isolate
138
Members
47
Samples
131
Scaffolds
235.38
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_391961|Ga0466699_391961_3858_4652
- Length
- 264 aa
- Sequence
- MIHNNRKVNPYDTPLDTNSPNQYLITIRRNPMIQLPLAGSDKKITINPSKIIAVGLNYREHIKESLTFGDKPHDLPKEPVLFAKTTNVLIGPGEPIVIPAHIKEYNFEDERVDPECELAIIIGKRGRHIPEEKAFDYVLGYTCFNDVSQRNIQKSDPSGWFRGKSFDTFGPIGPVIVSHNDIGNPQALNVTCKINGVLKQSGNTAEMIFPLPVLISYISKQFTLEEGDVIATGTPSGISPIVPGDTVEVEIEKIGILRNPVTAE
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Kalotermitidae
29.8%
Unclassified
17.0%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 8 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 21 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 38 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 39 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_122274 | 3300042614 | Bacteria | 1302 |
| 2 | Ga0466715_219377 | 3300042616 | Bacteria | 3736 |
| 3 | Ga0466715_398268 | 3300042616 | Bacteria | 4524 |
| 4 | Ga0466715_507006 | 3300042616 | Bacteria | 1384 |
| 5 | Ga0466700_287812 | 3300042600 | Bacteria | 1307 |
| 6 | Ga0466716_166989 | 3300042605 | Bacteria | 1435 |
| 7 | Ga0466690_182141 | 3300042590 | Bacteria | 3883 |
| 8 | Ga0466691_069494 | 3300042593 | Bacteria | 5723 |
| 9 | Ga0466699_044841 | 3300042597 | Bacteria | 2170 |
| 10 | Ga0123356_10485816 | 3300010049 | Bacteria | 1389 |
| 11 | Ga0466735_173907 | 3300042624 | Bacteria | 1487 |
| 12 | Ga0466709_209315 | 3300042648 | Bacteria | 6549 |
| 13 | Ga0466727_184612 | 3300042655 | Bacteria | 12843 |
| 14 | Ga0466705_484253 | 3300042612 | Bacteria | 10481 |
| 15 | Ga0466712_009972 | 3300042614 | Bacteria | 29783 |
| 16 | Ga0466712_079618 | 3300042614 | Unclassified | 3459 |
| 17 | Ga0466712_313318 | 3300042614 | Bacteria | 28274 |
| 18 | Ga0466718_011124 | 3300042617 | Bacteria | 10964 |
| 19 | Ga0466726_227930 | 3300042619 | Bacteria | 5980 |
| 20 | Ga0466707_347807 | 3300042601 | Bacteria | 1189 |
| 21 | Ga0466716_191381 | 3300042605 | Bacteria | 1026 |
| 22 | Ga0466719_450751 | 3300042606 | Bacteria | 6981 |
| 23 | Ga0466720_099690 | 3300042607 | Bacteria | 2693 |
| 24 | Ga0466722_228701 | 3300042609 | Bacteria | 35562 |
| 25 | Ga0466694_190203 | 3300042594 | Bacteria | 3364 |
| 26 | Ga0466694_273673 | 3300042594 | Bacteria | 1695 |
| 27 | Ga0466695_168570 | 3300042595 | Bacteria | 1973 |
| 28 | Ga0123353_10203806 | 3300010167 | Bacteria | 3109 |
| 29 | Ga0123353_10549016 | 3300010167 | Bacteria | 1667 |
| 30 | JGI24698J34947_10000158 | 3300002449 | Bacteria | 25936 |
| 31 | JGI24698J34947_10026404 | 3300002449 | Bacteria | 3086 |
| 32 | Ga0466704_021624 | 3300042643 | Bacteria | 9498 |
| 33 | Ga0466715_503026 | 3300042616 | Bacteria | 1375 |
| 34 | Ga0466723_084496 | 3300042618 | Bacteria | 9020 |
| 35 | Ga0466726_013646 | 3300042619 | Bacteria | 1086 |
| 36 | Ga0466716_023346 | 3300042605 | Bacteria | 3241 |
| 37 | Ga0456237_0000545 | 3300041968 | Bacteria | 5739 |
| 38 | Ga0466696_020828 | 3300042596 | Bacteria | 4228 |
| 39 | Ga0466699_309354 | 3300042597 | Bacteria | 2677 |
| 40 | Ga0123354_10327261 | 3300010882 | Bacteria | 1403 |
| 41 | JGI24698J34947_10051143 | 3300002449 | Bacteria | 2080 |
| 42 | Ga0466705_093453 | 3300042612 | Bacteria | 20079 |
| 43 | Ga0466709_012349 | 3300042648 | Bacteria | 25902 |
| 44 | Ga0466708_284625 | 3300042652 | Bacteria | 6267 |
| 45 | Ga0466712_170442 | 3300042614 | Bacteria | 1456 |
| 46 | Ga0466707_148278 | 3300042601 | Bacteria | 1054 |
| 47 | Ga0466722_089713 | 3300042609 | Bacteria | 16413 |
| 48 | Ga0415639_157759 | 3300038395 | Unclassified | 1103 |
| 49 | Ga0466699_135192 | 3300042597 | Bacteria | 1731 |
| 50 | Ga0123355_10001378 | 3300009826 | Bacteria | 33829 |
| 51 | Ga0123353_10526488 | 3300010167 | Bacteria | 1713 |
| 52 | Ga0123354_10048261 | 3300010882 | Bacteria | 6477 |
| 53 | JGI24698J34947_10005247 | 3300002449 | Bacteria | 7110 |
| 54 | JGI24698J34947_10022614 | 3300002449 | Bacteria | 3370 |
| 55 | JGI24700J35501_10930900 | 3300002508 | Bacteria | 36836 |
| 56 | Ga0466705_134384 | 3300042612 | Bacteria | 2720 |
| 57 | Ga0466703_096245 | 3300042636 | Bacteria | 24356 |
| 58 | Ga0466703_102880 | 3300042636 | Bacteria | 2268 |
| 59 | Ga0466704_198295 | 3300042643 | Bacteria | 6279 |
| 60 | Ga0466704_604602 | 3300042643 | Bacteria | 3473 |
| 61 | Ga0466711_482729 | 3300042615 | Bacteria | 7454 |
| 62 | Ga0466715_045624 | 3300042616 | Bacteria | 12736 |
| 63 | Ga0466728_087613 | 3300042620 | Bacteria | 22622 |
| 64 | Ga0466728_341928 | 3300042620 | Bacteria | 4971 |
| 65 | Ga0466728_381622 | 3300042620 | Bacteria | 6445 |
| 66 | Ga0466722_032150 | 3300042609 | Bacteria | 5466 |
| 67 | Ga0466694_045629 | 3300042594 | Bacteria | 1124 |
| 68 | Ga0466699_391961 | 3300042597 | Bacteria | 4868 |
| 69 | Ga0123353_10163001 | 3300010167 | Bacteria | 3547 |
| 70 | Ga0123353_10402425 | 3300010167 | Bacteria | 2037 |
| 71 | Ga0123353_10587140 | 3300010167 | Bacteria | 1596 |
| 72 | JGI24702J35022_10011288 | 3300002462 | Bacteria | 4980 |
| 73 | JGI24702J35022_10168290 | 3300002462 | Bacteria | 1238 |
| 74 | JGI24705J35276_12220830 | 3300002504 | Bacteria | 2293 |
| 75 | Ga0466705_062998 | 3300042612 | Bacteria | 6202 |
| 76 | Ga0466705_123366 | 3300042612 | Bacteria | 3839 |
| 77 | Ga0466729_248528 | 3300042621 | Bacteria | 1295 |
| 78 | Ga0466729_302655 | 3300042621 | Bacteria | 1731 |
| 79 | Ga0466735_219380 | 3300042624 | Bacteria | 1502 |
| 80 | Ga0466704_293514 | 3300042643 | Bacteria | 5518 |
| 81 | Ga0466709_204865 | 3300042648 | Bacteria | 1771 |
| 82 | Ga0466708_247180 | 3300042652 | Bacteria | 6066 |
| 83 | Ga0466712_039038 | 3300042614 | Bacteria | 39310 |
| 84 | Ga0466715_026615 | 3300042616 | Bacteria | 1207 |
| 85 | Ga0466715_074473 | 3300042616 | Bacteria | 4742 |
| 86 | Ga0466696_209387 | 3300042596 | Bacteria | 2258 |
| 87 | Ga0123357_10180888 | 3300009784 | Bacteria | 2462 |
| 88 | Ga0123353_10803280 | 3300010167 | Bacteria | 1298 |
| 89 | Ga0123353_11238659 | 3300010167 | Bacteria | 975 |
| 90 | Ga0123354_10465150 | 3300010882 | Bacteria | 1012 |
| 91 | JGI24698J34947_10001764 | 3300002449 | Bacteria | 11529 |
| 92 | Ga0466709_064420 | 3300042648 | Bacteria | 20812 |
| 93 | Ga0466712_203843 | 3300042614 | Bacteria | 11185 |
| 94 | Ga0466712_205602 | 3300042614 | Bacteria | 11927 |
| 95 | Ga0466715_342340 | 3300042616 | Bacteria | 4967 |
| 96 | Ga0466715_641799 | 3300042616 | Bacteria | 5422 |
| 97 | Ga0466723_126188 | 3300042618 | Bacteria | 2922 |
| 98 | Ga0466726_192760 | 3300042619 | Bacteria | 6394 |
| 99 | Ga0466716_283417 | 3300042605 | Bacteria | 15850 |
| 100 | Ga0466719_235561 | 3300042606 | Bacteria | 1159 |
| 101 | Ga0456237_0006641 | 3300041968 | Bacteria | 1805 |
| 102 | Ga0466692_001784 | 3300042591 | Bacteria | 8377 |
| 103 | Ga0466692_083130 | 3300042591 | Bacteria | 2889 |
| 104 | Ga0466691_059522 | 3300042593 | Bacteria | 11088 |
| 105 | Ga0123355_10019401 | 3300009826 | Bacteria | 10826 |
| 106 | Ga0123353_10123215 | 3300010167 | Bacteria | 4166 |
| 107 | Ga0123354_10324917 | 3300010882 | Bacteria | 1413 |
| 108 | Ga0123354_10382907 | 3300010882 | Bacteria | 1212 |
| 109 | JGI24702J35022_10009800 | 3300002462 | Bacteria | 5370 |
| 110 | JGI24702J35022_10080351 | 3300002462 | Bacteria | 1766 |
| 111 | Ga0123357_10000061 | 3300009784 | Bacteria | 85874 |
| 112 | Ga0466704_348330 | 3300042643 | Bacteria | 22818 |
| 113 | Ga0466704_349883 | 3300042643 | Bacteria | 6408 |
| 114 | Ga0466708_040831 | 3300042652 | Bacteria | 1540 |
| 115 | Ga0466727_111549 | 3300042655 | Bacteria | 1684 |
| 116 | Ga0466715_371870 | 3300042616 | Bacteria | 2485 |
| 117 | Ga0466723_099808 | 3300042618 | Bacteria | 1912 |
| 118 | Ga0466728_297992 | 3300042620 | Bacteria | 1546 |
| 119 | Ga0466707_386472 | 3300042601 | Bacteria | 1940 |
| 120 | Ga0466694_244121 | 3300042594 | Bacteria | 8492 |
| 121 | Ga0466699_138614 | 3300042597 | Bacteria | 2628 |
| 122 | Ga0466699_206795 | 3300042597 | Unclassified | 2080 |
| 123 | Ga0123357_10245972 | 3300009784 | Bacteria | 1926 |
| 124 | Ga0123356_10541488 | 3300010049 | Bacteria | 1324 |
| 125 | Ga0123353_10161068 | 3300010167 | Bacteria | 3572 |
| 126 | Ga0123353_10297345 | 3300010167 | Bacteria | 2467 |
| 127 | JGI24698J34947_10016692 | 3300002449 | Unclassified | 3983 |
| 128 | JGI24695J34938_10068326 | 3300002450 | Bacteria | 1493 |
| 129 | Ga0466704_361364 | 3300042643 | Bacteria | 1406 |
| 130 | Ga0466708_320263 | 3300042652 | Bacteria | 2815 |
| 131 | Ga0466727_244714 | 3300042655 | Bacteria | 1475 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01557 | FAA_hydrolase | Fumarylacetoacetate (FAA) hydrolase family | 50 | 261 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01557 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.