Protein Family IF05361
Metagenome
Isolate
219
Members
68
Samples
199
Scaffolds
249.36
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_339939|Ga0466699_339939_256_993
- Length
- 245 aa
- Sequence
- MLADLHNHSCLSPCGSLDLSPRRLVEEGAARGIKLMALTDHNSTLNCPAFAKLCPKYGIIPIFGMEATTSEEIHVLCLFTDLEASMAFNLYAYSILTPFLNNPKKTGDQVYVDENDDIEGEVEYYLVNPLNLSIDDIGEKVTKYGGIVIPAHVDRPAFSMTSQLGIIVQGPWAALECVRIPPMLDGFPLRTKGYPLTTSSDAHYPEHVGRRPFEIDVTAEELQPGGYGTSANMEAFVNALAKRPK
Sample Types
Isolate
9.1%
Metagenome
90.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Unclassified
30.8%
Kalotermitidae
20.0%
Rhinotermitidae
4.6%
Hodotermitidae
1.5%
Termopsidae
1.5%
Taxonomy
Archaea
0
Bacteria
207
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 13 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 27 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 28 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 29 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 30 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 33 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 34 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 37 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 44 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 45 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 48 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 49 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 52 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 55 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 56 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 57 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 60 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 64 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 67 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 68 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_033143 | 3300042612 | Bacteria | 2367 |
| 2 | Ga0466732_137726 | 3300042656 | Bacteria | 2020 |
| 3 | Ga0466699_340508 | 3300042597 | Bacteria | 1233 |
| 4 | Ga0123356_10006850 | 3300010049 | Bacteria | 11461 |
| 5 | Ga0466702_293893 | 3300042635 | Bacteria | 3239 |
| 6 | Ga0466703_020769 | 3300042636 | Bacteria | 4996 |
| 7 | Ga0466703_026300 | 3300042636 | Bacteria | 3562 |
| 8 | Ga0466704_263974 | 3300042643 | Bacteria | 14249 |
| 9 | JGI24698J34947_10010770 | 3300002449 | Bacteria | 5019 |
| 10 | JGI24698J34947_10057246 | 3300002449 | Bacteria | 1935 |
| 11 | Ga0072940_1071788 | 3300005200 | Bacteria | 5612 |
| 12 | Ga0466712_109797 | 3300042614 | Bacteria | 5018 |
| 13 | Ga0466712_173871 | 3300042614 | Bacteria | 3049 |
| 14 | Ga0466712_257319 | 3300042614 | Bacteria | 4171 |
| 15 | Ga0466726_239370 | 3300042619 | Bacteria | 2237 |
| 16 | Ga0466719_010748 | 3300042606 | Unclassified | 6360 |
| 17 | Ga0466719_286464 | 3300042606 | Bacteria | 5819 |
| 18 | Ga0466722_009201 | 3300042609 | Bacteria | 3728 |
| 19 | Ga0415639_020473 | 3300038395 | Bacteria | 9454 |
| 20 | Ga0466690_018660 | 3300042590 | Bacteria | 9248 |
| 21 | Ga0466693_129414 | 3300042592 | Bacteria | 7320 |
| 22 | Ga0466695_316094 | 3300042595 | Bacteria | 79149 |
| 23 | Ga0466699_233516 | 3300042597 | Bacteria | 5694 |
| 24 | Ga0123356_10000063 | 3300010049 | Bacteria | 111723 |
| 25 | Ga0123356_10015721 | 3300010049 | Bacteria | 7244 |
| 26 | Ga0123356_10392795 | 3300010049 | Bacteria | 1523 |
| 27 | Ga0123354_10044626 | 3300010882 | Bacteria | 6795 |
| 28 | Ga0466731_314277 | 3300042622 | Bacteria | 2057 |
| 29 | Ga0466731_369504 | 3300042622 | Bacteria | 1148 |
| 30 | Ga0466709_363059 | 3300042648 | Bacteria | 2219 |
| 31 | Ga0466708_392530 | 3300042652 | Bacteria | 1679 |
| 32 | AustNasuHG_c1009075 | 3300000089 | Bacteria | 3505 |
| 33 | JGI24698J34947_10003376 | 3300002449 | Bacteria | 8663 |
| 34 | JGI24698J34947_10006235 | 3300002449 | Bacteria | 6551 |
| 35 | JGI24698J34947_10007887 | 3300002449 | Bacteria | 5848 |
| 36 | JGI24698J34947_10077216 | 3300002449 | Unclassified | 1575 |
| 37 | JGI24695J34938_10001492 | 3300002450 | Unclassified | 19750 |
| 38 | Ga0072940_1026156 | 3300005200 | Bacteria | 3283 |
| 39 | Ga0072940_1081040 | 3300005200 | Bacteria | 3481 |
| 40 | Ga0466712_038826 | 3300042614 | Bacteria | 4598 |
| 41 | Ga0466712_204469 | 3300042614 | Bacteria | 34311 |
| 42 | Ga0466712_319340 | 3300042614 | Unclassified | 1521 |
| 43 | Ga0466715_494253 | 3300042616 | Bacteria | 11501 |
| 44 | Ga0466719_188995 | 3300042606 | Bacteria | 1859 |
| 45 | Ga0466722_179546 | 3300042609 | Bacteria | 2005 |
| 46 | Ga0264413_113896 | 3300024493 | Bacteria | 3995 |
| 47 | Ga0466691_226294 | 3300042593 | Bacteria | 1643 |
| 48 | Ga0466696_040982 | 3300042596 | Bacteria | 8706 |
| 49 | Ga0466699_156817 | 3300042597 | Bacteria | 3573 |
| 50 | Ga0466699_339939 | 3300042597 | Bacteria | 1234 |
| 51 | Ga0466699_366055 | 3300042597 | Bacteria | 1982 |
| 52 | Ga0466699_367815 | 3300042597 | Bacteria | 1457 |
| 53 | Ga0123356_10010222 | 3300010049 | Bacteria | 9229 |
| 54 | Ga0466703_103011 | 3300042636 | Bacteria | 1337 |
| 55 | Ga0466709_014757 | 3300042648 | Bacteria | 5546 |
| 56 | Ga0466708_010824 | 3300042652 | Bacteria | 9485 |
| 57 | 2230954234 | 2228664003 | Bacteria | 8326 |
| 58 | AustNasuHG_c1002282 | 3300000089 | Bacteria | 6924 |
| 59 | JGI24698J34947_10018428 | 3300002449 | Bacteria | 3772 |
| 60 | JGI24698J34947_10030612 | 3300002449 | Unclassified | 2837 |
| 61 | JGI24695J34938_10011808 | 3300002450 | Bacteria | 4680 |
| 62 | Ga0072941_1017607 | 3300005201 | Bacteria | 11408 |
| 63 | Ga0466712_016139 | 3300042614 | Bacteria | 3249 |
| 64 | Ga0466712_023524 | 3300042614 | Bacteria | 21459 |
| 65 | Ga0466712_071152 | 3300042614 | Bacteria | 2284 |
| 66 | Ga0466712_099913 | 3300042614 | Bacteria | 1588 |
| 67 | Ga0466715_305635 | 3300042616 | Bacteria | 13616 |
| 68 | Ga0466723_194404 | 3300042618 | Bacteria | 15572 |
| 69 | Ga0466719_012338 | 3300042606 | Bacteria | 1742 |
| 70 | Ga0466720_027618 | 3300042607 | Bacteria | 12153 |
| 71 | Ga0466722_189051 | 3300042609 | Bacteria | 5749 |
| 72 | Ga0466705_025003 | 3300042612 | Bacteria | 6848 |
| 73 | Ga0466732_375208 | 3300042656 | Bacteria | 7755 |
| 74 | Ga0264413_113898 | 3300024493 | Bacteria | 2732 |
| 75 | Ga0415639_020474 | 3300038395 | Bacteria | 8872 |
| 76 | Ga0415639_076320 | 3300038395 | Bacteria | 7706 |
| 77 | Ga0466691_031528 | 3300042593 | Bacteria | 3240 |
| 78 | Ga0466691_165581 | 3300042593 | Bacteria | 6201 |
| 79 | Ga0466694_210720 | 3300042594 | Bacteria | 12727 |
| 80 | Ga0466699_328633 | 3300042597 | Bacteria | 10088 |
| 81 | Ga0123356_10019159 | 3300010049 | Bacteria | 6489 |
| 82 | Ga0123356_10609528 | 3300010049 | Bacteria | 1257 |
| 83 | Ga0123353_10638100 | 3300010167 | Bacteria | 1511 |
| 84 | Ga0466702_168430 | 3300042635 | Bacteria | 13812 |
| 85 | Ga0466703_103262 | 3300042636 | Bacteria | 2822 |
| 86 | Ga0466704_023890 | 3300042643 | Bacteria | 26000 |
| 87 | Ga0466708_225874 | 3300042652 | Bacteria | 2565 |
| 88 | JGI24702J35022_10005919 | 3300002462 | Bacteria | 7105 |
| 89 | JGI24699J35502_11114578 | 3300002509 | Bacteria | 2868 |
| 90 | Ga0072940_1024164 | 3300005200 | Bacteria | 4612 |
| 91 | Ga0466712_012540 | 3300042614 | Bacteria | 1218 |
| 92 | Ga0466712_015397 | 3300042614 | Bacteria | 4084 |
| 93 | Ga0466712_120776 | 3300042614 | Bacteria | 2802 |
| 94 | Ga0466715_529759 | 3300042616 | Bacteria | 8130 |
| 95 | Ga0466718_081473 | 3300042617 | Bacteria | 1492 |
| 96 | Ga0466719_280107 | 3300042606 | Bacteria | 1454 |
| 97 | Ga0466705_169042 | 3300042612 | Bacteria | 5498 |
| 98 | Ga0264413_100675 | 3300024493 | Bacteria | 52863 |
| 99 | Ga0415639_063362 | 3300038395 | Bacteria | 4566 |
| 100 | Ga0466692_038423 | 3300042591 | Bacteria | 1994 |
| 101 | Ga0466694_079091 | 3300042594 | Bacteria | 9195 |
| 102 | Ga0466694_314898 | 3300042594 | Bacteria | 1177 |
| 103 | Ga0466694_329346 | 3300042594 | Bacteria | 1383 |
| 104 | Ga0123356_10000045 | 3300010049 | Bacteria | 131000 |
| 105 | Ga0123353_10417449 | 3300010167 | Bacteria | 1989 |
| 106 | Ga0466702_081463 | 3300042635 | Bacteria | 4102 |
| 107 | Ga0466702_242182 | 3300042635 | Bacteria | 1528 |
| 108 | Ga0466703_056533 | 3300042636 | Unclassified | 5433 |
| 109 | Ga0466709_348184 | 3300042648 | Bacteria | 3005 |
| 110 | Ga0466708_045381 | 3300042652 | Bacteria | 24821 |
| 111 | Ga0466708_214520 | 3300042652 | Bacteria | 29049 |
| 112 | AustNasuHG_c1018190 | 3300000089 | Bacteria | 2324 |
| 113 | FAAS_10002199 | 3300001880 | Unclassified | 1778 |
| 114 | JGI24698J34947_10000696 | 3300002449 | Bacteria | 16443 |
| 115 | JGI24698J34947_10007059 | 3300002449 | Bacteria | 6174 |
| 116 | JGI24698J34947_10074914 | 3300002449 | Bacteria | 1611 |
| 117 | JGI24695J34938_10000158 | 3300002450 | Bacteria | 62584 |
| 118 | JGI24695J34938_10002817 | 3300002450 | Bacteria | 12700 |
| 119 | Ga0466715_605079 | 3300042616 | Bacteria | 5949 |
| 120 | Ga0466718_011452 | 3300042617 | Bacteria | 22863 |
| 121 | Ga0466706_285595 | 3300042599 | Bacteria | 1709 |
| 122 | Ga0466720_029569 | 3300042607 | Bacteria | 6043 |
| 123 | Ga0466720_164322 | 3300042607 | Bacteria | 18462 |
| 124 | Ga0466722_008273 | 3300042609 | Bacteria | 1630 |
| 125 | Ga0466696_225377 | 3300042596 | Bacteria | 6030 |
| 126 | Ga0123357_10217496 | 3300009784 | Bacteria | 2129 |
| 127 | Ga0123356_10001116 | 3300010049 | Bacteria | 29729 |
| 128 | Ga0123356_10002914 | 3300010049 | Bacteria | 18121 |
| 129 | Ga0466702_084647 | 3300042635 | Bacteria | 3854 |
| 130 | Ga0466702_235406 | 3300042635 | Bacteria | 7428 |
| 131 | Ga0466702_286786 | 3300042635 | Bacteria | 2872 |
| 132 | Ga0466702_366568 | 3300042635 | Bacteria | 22753 |
| 133 | Ga0466703_048977 | 3300042636 | Bacteria | 7963 |
| 134 | Ga0466703_142305 | 3300042636 | Bacteria | 3650 |
| 135 | Ga0466703_319431 | 3300042636 | Bacteria | 8308 |
| 136 | Ga0466708_449117 | 3300042652 | Unclassified | 1665 |
| 137 | JGI24698J34947_10016621 | 3300002449 | Bacteria | 3992 |
| 138 | JGI24698J34947_10039302 | 3300002449 | Unclassified | 2450 |
| 139 | Ga0466705_399123 | 3300042612 | Bacteria | 7377 |
| 140 | Ga0466712_001635 | 3300042614 | Bacteria | 7371 |
| 141 | Ga0466712_005234 | 3300042614 | Bacteria | 11219 |
| 142 | Ga0466712_017192 | 3300042614 | Bacteria | 18543 |
| 143 | Ga0466712_235452 | 3300042614 | Bacteria | 3497 |
| 144 | Ga0466711_109841 | 3300042615 | Bacteria | 1161 |
| 145 | Ga0466711_417623 | 3300042615 | Bacteria | 4932 |
| 146 | Ga0466715_268437 | 3300042616 | Bacteria | 23309 |
| 147 | Ga0466726_096778 | 3300042619 | Bacteria | 2632 |
| 148 | Ga0466728_054740 | 3300042620 | Bacteria | 2363 |
| 149 | Ga0466729_114495 | 3300042621 | Bacteria | 4640 |
| 150 | Ga0466719_101432 | 3300042606 | Bacteria | 5272 |
| 151 | Ga0466719_287649 | 3300042606 | Bacteria | 5670 |
| 152 | Ga0466720_046939 | 3300042607 | Bacteria | 11372 |
| 153 | Ga0466720_090065 | 3300042607 | Bacteria | 2095 |
| 154 | Ga0466732_116067 | 3300042656 | Bacteria | 16533 |
| 155 | Ga0466732_327785 | 3300042656 | Bacteria | 16850 |
| 156 | Ga0466691_037564 | 3300042593 | Bacteria | 9147 |
| 157 | Ga0466691_081319 | 3300042593 | Bacteria | 12247 |
| 158 | Ga0466694_339983 | 3300042594 | Bacteria | 5584 |
| 159 | Ga0466699_084136 | 3300042597 | Bacteria | 29498 |
| 160 | Ga0123356_10076854 | 3300010049 | Bacteria | 3147 |
| 161 | Ga0123356_10262008 | 3300010049 | Bacteria | 1813 |
| 162 | Ga0466702_385326 | 3300042635 | Bacteria | 9577 |
| 163 | Ga0466709_137222 | 3300042648 | Bacteria | 17191 |
| 164 | JGI24698J34947_10010608 | 3300002449 | Bacteria | 5055 |
| 165 | JGI24698J34947_10019594 | 3300002449 | Unclassified | 3646 |
| 166 | JGI24698J34947_10024473 | 3300002449 | Unclassified | 3224 |
| 167 | JGI24698J34947_10060124 | 3300002449 | Bacteria | 1876 |
| 168 | JGI24695J34938_10004086 | 3300002450 | Bacteria | 9742 |
| 169 | JGI24696J40584_12932420 | 3300002834 | Bacteria | 1502 |
| 170 | Ga0072940_1024163 | 3300005200 | Bacteria | 4978 |
| 171 | Ga0466712_046412 | 3300042614 | Bacteria | 17347 |
| 172 | Ga0466712_083862 | 3300042614 | Bacteria | 5252 |
| 173 | Ga0466711_213624 | 3300042615 | Bacteria | 16810 |
| 174 | Ga0466715_301875 | 3300042616 | Bacteria | 3395 |
| 175 | Ga0466718_039068 | 3300042617 | Bacteria | 1589 |
| 176 | Ga0466723_002508 | 3300042618 | Bacteria | 14472 |
| 177 | Ga0466700_026393 | 3300042600 | Bacteria | 2034 |
| 178 | Ga0466700_382265 | 3300042600 | Bacteria | 2638 |
| 179 | Ga0466720_165115 | 3300042607 | Bacteria | 7637 |
| 180 | Ga0466705_069699 | 3300042612 | Bacteria | 4245 |
| 181 | Ga0466705_083491 | 3300042612 | Unclassified | 1608 |
| 182 | Ga0466733_113569 | 3300042659 | Bacteria | 5860 |
| 183 | Ga0123356_10002707 | 3300010049 | Bacteria | 18827 |
| 184 | Ga0466702_212852 | 3300042635 | Bacteria | 1569 |
| 185 | Ga0466708_382642 | 3300042652 | Bacteria | 1838 |
| 186 | AustNasuHG_c1001824 | 3300000089 | Bacteria | 7703 |
| 187 | JGI24695J34938_10000583 | 3300002450 | Bacteria | 35239 |
| 188 | JGI24695J34938_10000880 | 3300002450 | Bacteria | 27708 |
| 189 | JGI24695J34938_10001856 | 3300002450 | Bacteria | 17162 |
| 190 | JGI24695J34938_10019912 | 3300002450 | Bacteria | 3312 |
| 191 | JGI24695J34938_10031488 | 3300002450 | Bacteria | 2460 |
| 192 | Ga0074263_115081 | 3300005485 | Bacteria | 2776 |
| 193 | Ga0466712_006083 | 3300042614 | Bacteria | 9599 |
| 194 | Ga0466712_050352 | 3300042614 | Bacteria | 17173 |
| 195 | Ga0466711_053464 | 3300042615 | Bacteria | 2969 |
| 196 | Ga0466711_146978 | 3300042615 | Bacteria | 12045 |
| 197 | Ga0466720_116740 | 3300042607 | Bacteria | 72912 |
| 198 | Ga0466720_233881 | 3300042607 | Bacteria | 13856 |
| 199 | Ga0466698_074368 | 3300042610 | Bacteria | 1813 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02811 | PHP | PHP domain | 4 | 76 | 0.81 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02811 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.