Protein Family IF05359
Metagenome
Isolate
139
Members
37
Samples
134
Scaffolds
185.19
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_323471|Ga0466699_323471_790_1416
- Length
- 208 aa
- Sequence
- LDQAGLADSILWATVNIDSGRKGFATRGKAEEGRISYETGIDEALTAFKEAQATADPQTIILAEYTFITQELQFCEKSDKESITSLTKAIQSFDWKAGEPRQYNKFPLQRRTACNVVRPDAFLALKVVEDRTLYQGAEQIIPHDSKYRVKGFPKDSFHIACGSHKTRIQNMLKTPGIDPIEKALLKQRLANLPAAQNGYIEKQKKALA
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
75.0%
Unclassified
13.9%
Kalotermitidae
8.3%
Termopsidae
2.8%
Taxonomy
Archaea
1
Bacteria
125
Eukaryota
0
Viruses
1
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 20 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 21 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 22 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_102803 | 3300042656 | Unclassified | 8042 |
| 2 | Ga0123356_10122693 | 3300010049 | Bacteria | 2531 |
| 3 | Ga0466699_103803 | 3300042597 | Bacteria | 1023 |
| 4 | Ga0466699_344505 | 3300042597 | Bacteria | 1461 |
| 5 | Ga0466714_039913 | 3300042603 | Bacteria | 5130 |
| 6 | Ga0466719_332181 | 3300042606 | Bacteria | 1407 |
| 7 | Ga0466720_084657 | 3300042607 | Bacteria | 1374 |
| 8 | Ga0466698_328519 | 3300042610 | Bacteria | 1829 |
| 9 | Ga0466731_206657 | 3300042622 | Bacteria | 1687 |
| 10 | Ga0466702_354806 | 3300042635 | Bacteria | 1099 |
| 11 | Ga0466712_062586 | 3300042614 | Bacteria | 1293 |
| 12 | Ga0466712_208807 | 3300042614 | Bacteria | 2261 |
| 13 | Ga0466726_133060 | 3300042619 | Bacteria | 9893 |
| 14 | AustNasuHG_c1049758 | 3300000089 | Bacteria | 908 |
| 15 | JGI24698J34947_10020202 | 3300002449 | Bacteria | 3590 |
| 16 | JGI24698J34947_10128228 | 3300002449 | Bacteria | 1089 |
| 17 | JGI24698J34947_10219729 | 3300002449 | Unclassified | 730 |
| 18 | JGI24695J34938_10004263 | 3300002450 | Bacteria | 9476 |
| 19 | Ga0072941_1079838 | 3300005201 | Bacteria | 684 |
| 20 | Ga0466732_271934 | 3300042656 | Unclassified | 1305 |
| 21 | Ga0466694_173277 | 3300042594 | Unclassified | 1007 |
| 22 | Ga0466699_021998 | 3300042597 | Bacteria | 1161 |
| 23 | Ga0466699_159396 | 3300042597 | Bacteria | 2199 |
| 24 | Ga0466699_198284 | 3300042597 | Bacteria | 1013 |
| 25 | Ga0466699_342175 | 3300042597 | Bacteria | 1515 |
| 26 | Ga0466717_263310 | 3300042604 | Bacteria | 1152 |
| 27 | Ga0466712_322477 | 3300042614 | Bacteria | 1816 |
| 28 | AustNasuHG_c1000277 | 3300000089 | Unclassified | 17629 |
| 29 | AustNasuHG_c1032051 | 3300000089 | Bacteria | 1467 |
| 30 | JGI24698J34947_10034087 | 3300002449 | Bacteria | 2667 |
| 31 | JGI24698J34947_10069171 | 3300002449 | Bacteria | 1704 |
| 32 | JGI24698J34947_10172019 | 3300002449 | Bacteria | 875 |
| 33 | JGI24698J34947_10178450 | 3300002449 | Bacteria | 852 |
| 34 | JGI24697J35500_11252214 | 3300002507 | Bacteria | 2572 |
| 35 | Ga0072941_1010809 | 3300005201 | Bacteria | 19439 |
| 36 | Ga0123355_10332492 | 3300009826 | Bacteria | 2033 |
| 37 | Ga0123356_10000845 | 3300010049 | Bacteria | 34036 |
| 38 | Ga0123356_12383898 | 3300010049 | Bacteria | 662 |
| 39 | Ga0123353_11274984 | 3300010167 | Bacteria | 957 |
| 40 | Ga0415639_108156 | 3300038395 | Bacteria | 1602 |
| 41 | Ga0466699_323471 | 3300042597 | Bacteria | 1879 |
| 42 | Ga0466708_018278 | 3300042652 | Bacteria | 1084 |
| 43 | Ga0466712_050903 | 3300042614 | Bacteria | 2129 |
| 44 | Ga0466712_090776 | 3300042614 | Bacteria | 5714 |
| 45 | Ga0466712_091106 | 3300042614 | Bacteria | 4650 |
| 46 | Ga0466718_108095 | 3300042617 | Bacteria | 1184 |
| 47 | AustNasuHG_c1017672 | 3300000089 | Bacteria | 2368 |
| 48 | JGI24698J34947_10029327 | 3300002449 | Bacteria | 2907 |
| 49 | JGI24698J34947_10029999 | 3300002449 | Bacteria | 2870 |
| 50 | JGI24698J34947_10075030 | 3300002449 | Bacteria | 1609 |
| 51 | JGI24702J35022_10016615 | 3300002462 | Unclassified | 4031 |
| 52 | JGI24702J35022_10039819 | 3300002462 | Bacteria | 2507 |
| 53 | Ga0072941_1158867 | 3300005201 | Bacteria | 1231 |
| 54 | Ga0466733_086636 | 3300042659 | Bacteria | 1058 |
| 55 | Ga0466694_348836 | 3300042594 | Bacteria | 4252 |
| 56 | Ga0466699_131969 | 3300042597 | Bacteria | 1849 |
| 57 | Ga0466720_159627 | 3300042607 | Bacteria | 5075 |
| 58 | Ga0466731_150150 | 3300042622 | Bacteria | 73009 |
| 59 | Ga0466712_042735 | 3300042614 | Bacteria | 35616 |
| 60 | Ga0466712_210033 | 3300042614 | Bacteria | 1936 |
| 61 | Ga0466718_078634 | 3300042617 | Bacteria | 1201 |
| 62 | Ga0466726_360625 | 3300042619 | Bacteria | 3007 |
| 63 | AustNasuHG_c1010013 | 3300000089 | Unclassified | 3314 |
| 64 | AustNasuHG_c1026273 | 3300000089 | Bacteria | 1815 |
| 65 | AustNasuHG_c1035989 | 3300000089 | Unclassified | 1293 |
| 66 | JGI24698J34947_10030118 | 3300002449 | Archaea | 2864 |
| 67 | JGI24698J34947_10047171 | 3300002449 | Bacteria | 2188 |
| 68 | JGI24698J34947_10064981 | 3300002449 | Unclassified | 1780 |
| 69 | JGI24698J34947_10088521 | 3300002449 | Bacteria | 1428 |
| 70 | JGI24698J34947_10232615 | 3300002449 | Bacteria | 699 |
| 71 | Ga0072941_1009325 | 3300005201 | Bacteria | 25187 |
| 72 | Ga0072941_1027844 | 3300005201 | Bacteria | 7529 |
| 73 | Ga0072941_1054240 | 3300005201 | Bacteria | 2007 |
| 74 | Ga0072941_1056832 | 3300005201 | Bacteria | 1012 |
| 75 | Ga0466732_334739 | 3300042656 | Bacteria | 4134 |
| 76 | Ga0466699_118344 | 3300042597 | Bacteria | 1031 |
| 77 | Ga0466699_283930 | 3300042597 | Bacteria | 1670 |
| 78 | Ga0466699_412542 | 3300042597 | Bacteria | 6817 |
| 79 | Ga0466712_007763 | 3300042614 | Bacteria | 3534 |
| 80 | AustNasuHG_c1053698 | 3300000089 | Bacteria | 835 |
| 81 | JGI24698J34947_10007295 | 3300002449 | Bacteria | 6075 |
| 82 | JGI24698J34947_10012015 | 3300002449 | Bacteria | 4754 |
| 83 | JGI24698J34947_10030936 | 3300002449 | Bacteria | 2820 |
| 84 | JGI24698J34947_10034564 | 3300002449 | Bacteria | 2644 |
| 85 | JGI24698J34947_10154212 | 3300002449 | Bacteria | 949 |
| 86 | JGI24698J34947_10185483 | 3300002449 | Bacteria | 827 |
| 87 | JGI24698J34947_10251084 | 3300002449 | Unclassified | 661 |
| 88 | JGI24695J34938_10008728 | 3300002450 | Bacteria | 5745 |
| 89 | JGI24695J34938_10021048 | 3300002450 | Bacteria | 3199 |
| 90 | JGI24702J35022_10027919 | 3300002462 | Bacteria | 3036 |
| 91 | JGI24702J35022_10028860 | 3300002462 | Bacteria | 2979 |
| 92 | Ga0072941_1035223 | 3300005201 | Bacteria | 6846 |
| 93 | Ga0074263_146390 | 3300005485 | Bacteria | 772 |
| 94 | Ga0466699_184557 | 3300042597 | Bacteria | 1086 |
| 95 | Ga0466700_355258 | 3300042600 | Bacteria | 2028 |
| 96 | Ga0466720_196807 | 3300042607 | Bacteria | 2888 |
| 97 | Ga0466731_028485 | 3300042622 | Bacteria | 3083 |
| 98 | Ga0466731_281703 | 3300042622 | Bacteria | 1220 |
| 99 | Ga0466704_420584 | 3300042643 | Bacteria | 2290 |
| 100 | Ga0466712_043691 | 3300042614 | Bacteria | 1912 |
| 101 | Ga0466712_106586 | 3300042614 | Bacteria | 1232 |
| 102 | Ga0466712_317682 | 3300042614 | Bacteria | 1431 |
| 103 | AustNasuHG_c1009846 | 3300000089 | Bacteria | 3344 |
| 104 | AustNasuHG_c1019151 | 3300000089 | Bacteria | 2250 |
| 105 | JGI24698J34947_10028954 | 3300002449 | Bacteria | 2931 |
| 106 | JGI24698J34947_10032286 | 3300002449 | Bacteria | 2750 |
| 107 | JGI24698J34947_10115929 | 3300002449 | Bacteria | 1172 |
| 108 | JGI24698J34947_10178705 | 3300002449 | Bacteria | 851 |
| 109 | JGI24695J34938_10016586 | 3300002450 | Bacteria | 3741 |
| 110 | Ga0072940_1018627 | 3300005200 | Bacteria | 4244 |
| 111 | Ga0123356_10022698 | 3300010049 | Bacteria | 5917 |
| 112 | Ga0466699_157175 | 3300042597 | Bacteria | 55178 |
| 113 | Ga0466699_310838 | 3300042597 | Bacteria | 14367 |
| 114 | Ga0466701_028132 | 3300042598 | Bacteria | 1092 |
| 115 | Ga0466720_099475 | 3300042607 | Bacteria | 1807 |
| 116 | Ga0466712_024304 | 3300042614 | Bacteria | 1611 |
| 117 | Ga0466712_111925 | 3300042614 | Bacteria | 2087 |
| 118 | Ga0466712_126912 | 3300042614 | Bacteria | 1186 |
| 119 | Ga0466712_185500 | 3300042614 | Unclassified | 1236 |
| 120 | AustNasuHG_c1039052 | 3300000089 | Bacteria | 1185 |
| 121 | AustNasuHG_c1041704 | 3300000089 | Bacteria | 1102 |
| 122 | JGI24698J34947_10092510 | 3300002449 | Unclassified | 1383 |
| 123 | JGI24705J35276_11827251 | 3300002504 | Bacteria | 700 |
| 124 | Ga0072941_1005485 | 3300005201 | Bacteria | 9335 |
| 125 | Ga0123356_10023080 | 3300010049 | Bacteria | 5861 |
| 126 | Ga0123353_10749643 | 3300010167 | Bacteria | 1359 |
| 127 | Ga0466699_023929 | 3300042597 | Viruses | 2649 |
| 128 | Ga0466699_042446 | 3300042597 | Bacteria | 1252 |
| 129 | Ga0466698_492789 | 3300042610 | Bacteria | 1948 |
| 130 | Ga0466712_058489 | 3300042614 | Bacteria | 1216 |
| 131 | AustNasuHG_c1000108 | 3300000089 | Bacteria | 24878 |
| 132 | JGI24698J34947_10187598 | 3300002449 | Bacteria | 821 |
| 133 | JGI24699J35502_10787529 | 3300002509 | Bacteria | 862 |
| 134 | JGI24699J35502_10999295 | 3300002509 | Bacteria | 1345 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.