Protein Family IF05318
Metagenome
Isolate
156
Members
52
Samples
155
Scaffolds
96.9
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_172490|Ga0466699_172490_267_551
- Length
- 94 aa
- Sequence
- MKIIKGQSALRITLRTFADLDDCVSAVIKFRKPNGKTGEFEAAVDTAKGVIFHECFGGEINASGWWAFWAFVTFTDGRTAAGEAAKVYVWGEGG
Sample Types
Isolate
0.6%
Metagenome
99.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
58.8%
Kalotermitidae
23.5%
Rhinotermitidae
5.9%
Unclassified
5.9%
Termopsidae
5.9%
Taxonomy
Archaea
1
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_340691 | 3300042656 | Bacteria | 1432 |
| 2 | Ga0466732_440906 | 3300042656 | Bacteria | 2288 |
| 3 | Ga0466716_181002 | 3300042605 | Bacteria | 7172 |
| 4 | Ga0466719_398307 | 3300042606 | Bacteria | 2279 |
| 5 | Ga0466719_421943 | 3300042606 | Bacteria | 1005 |
| 6 | Ga0466720_170068 | 3300042607 | Bacteria | 1145 |
| 7 | Ga0466721_004056 | 3300042608 | Bacteria | 1217 |
| 8 | Ga0466722_191644 | 3300042609 | Bacteria | 1686 |
| 9 | Ga0466712_268061 | 3300042614 | Bacteria | 2962 |
| 10 | Ga0466711_042933 | 3300042615 | Bacteria | 1862 |
| 11 | Ga0466718_130531 | 3300042617 | Bacteria | 2827 |
| 12 | Ga0466718_152595 | 3300042617 | Bacteria | 1654 |
| 13 | Ga0466728_153150 | 3300042620 | Bacteria | 1817 |
| 14 | Ga0466656_126397 | 3300042550 | Bacteria | 2287 |
| 15 | Ga0466690_124178 | 3300042590 | Bacteria | 1764 |
| 16 | Ga0466694_162790 | 3300042594 | Bacteria | 3017 |
| 17 | Ga0466696_333210 | 3300042596 | Bacteria | 2706 |
| 18 | Ga0123356_10730305 | 3300010049 | Bacteria | 1160 |
| 19 | Ga0123353_10922771 | 3300010167 | Bacteria | 1185 |
| 20 | Ga0466735_147934 | 3300042624 | Bacteria | 11555 |
| 21 | Ga0466735_185676 | 3300042624 | Bacteria | 3043 |
| 22 | Ga0466703_040418 | 3300042636 | Bacteria | 1021 |
| 23 | Ga0466727_050302 | 3300042655 | Unclassified | 2634 |
| 24 | Ga0466727_058452 | 3300042655 | Unclassified | 2527 |
| 25 | AustNasuHG_c1038486 | 3300000089 | Bacteria | 1203 |
| 26 | Ga0466701_052316 | 3300042598 | Bacteria | 2596 |
| 27 | Ga0466701_079883 | 3300042598 | Bacteria | 1708 |
| 28 | Ga0466707_302822 | 3300042601 | Bacteria | 1203 |
| 29 | Ga0466707_351654 | 3300042601 | Bacteria | 1539 |
| 30 | Ga0466713_114008 | 3300042602 | Bacteria | 1659 |
| 31 | Ga0466720_058459 | 3300042607 | Bacteria | 1352 |
| 32 | Ga0466712_020763 | 3300042614 | Bacteria | 1510 |
| 33 | Ga0466728_379470 | 3300042620 | Bacteria | 1847 |
| 34 | Ga0466694_039896 | 3300042594 | Bacteria | 2731 |
| 35 | Ga0466696_143990 | 3300042596 | Bacteria | 7756 |
| 36 | Ga0466699_104292 | 3300042597 | Bacteria | 1065 |
| 37 | Ga0466735_036181 | 3300042624 | Bacteria | 3744 |
| 38 | Ga0466735_099228 | 3300042624 | Bacteria | 1213 |
| 39 | Ga0072941_1384854 | 3300005201 | Archaea | 2757 |
| 40 | Ga0466732_388680 | 3300042656 | Bacteria | 2142 |
| 41 | Ga0466707_229185 | 3300042601 | Bacteria | 2035 |
| 42 | Ga0466716_081010 | 3300042605 | Bacteria | 2535 |
| 43 | Ga0466698_467681 | 3300042610 | Bacteria | 1321 |
| 44 | Ga0466712_032829 | 3300042614 | Bacteria | 1645 |
| 45 | Ga0466715_148272 | 3300042616 | Unclassified | 2722 |
| 46 | Ga0466729_141108 | 3300042621 | Bacteria | 3184 |
| 47 | Ga0466657_118463 | 3300042582 | Bacteria | 1512 |
| 48 | Ga0466694_124625 | 3300042594 | Bacteria | 1215 |
| 49 | Ga0466694_191084 | 3300042594 | Unclassified | 1202 |
| 50 | Ga0123356_10998998 | 3300010049 | Bacteria | 1007 |
| 51 | Ga0466704_526085 | 3300042643 | Unclassified | 2093 |
| 52 | JGI24695J34938_10097188 | 3300002450 | Bacteria | 1205 |
| 53 | JGI24696J40584_12512298 | 3300002834 | Bacteria | 605 |
| 54 | Ga0072940_1086054 | 3300005200 | Bacteria | 4340 |
| 55 | Ga0466705_199171 | 3300042612 | Unclassified | 1019 |
| 56 | Ga0466732_301322 | 3300042656 | Bacteria | 2759 |
| 57 | Ga0466700_146676 | 3300042600 | Bacteria | 1050 |
| 58 | Ga0466717_081096 | 3300042604 | Bacteria | 2115 |
| 59 | Ga0466698_065312 | 3300042610 | Bacteria | 1227 |
| 60 | Ga0466712_232812 | 3300042614 | Bacteria | 12361 |
| 61 | Ga0466715_548299 | 3300042616 | Bacteria | 4183 |
| 62 | Ga0466718_121863 | 3300042617 | Bacteria | 1110 |
| 63 | Ga0466726_240375 | 3300042619 | Bacteria | 1059 |
| 64 | Ga0466726_299180 | 3300042619 | Bacteria | 1090 |
| 65 | Ga0415639_086929 | 3300038395 | Bacteria | 3744 |
| 66 | Ga0466694_066240 | 3300042594 | Bacteria | 2089 |
| 67 | Ga0466699_292100 | 3300042597 | Bacteria | 1180 |
| 68 | Ga0123356_10062511 | 3300010049 | Unclassified | 3478 |
| 69 | Ga0466703_190320 | 3300042636 | Bacteria | 10407 |
| 70 | Ga0466704_115886 | 3300042643 | Bacteria | 5373 |
| 71 | Ga0466727_195759 | 3300042655 | Bacteria | 1336 |
| 72 | JGI24702J35022_10041287 | 3300002462 | Bacteria | 2459 |
| 73 | Ga0072940_1138700 | 3300005200 | Bacteria | 857 |
| 74 | Ga0072941_1020858 | 3300005201 | Bacteria | 13396 |
| 75 | Ga0072941_1088796 | 3300005201 | Bacteria | 1237 |
| 76 | Ga0466705_056888 | 3300042612 | Bacteria | 1384 |
| 77 | Ga0466700_136848 | 3300042600 | Bacteria | 1007 |
| 78 | Ga0466719_399378 | 3300042606 | Bacteria | 1101 |
| 79 | Ga0466698_105408 | 3300042610 | Bacteria | 3739 |
| 80 | Ga0466715_010076 | 3300042616 | Bacteria | 1495 |
| 81 | Ga0466715_149698 | 3300042616 | Bacteria | 2248 |
| 82 | Ga0466718_026609 | 3300042617 | Bacteria | 2599 |
| 83 | Ga0466718_161485 | 3300042617 | Bacteria | 1259 |
| 84 | Ga0415639_029876 | 3300038395 | Bacteria | 2484 |
| 85 | Ga0466656_192107 | 3300042550 | Bacteria | 1111 |
| 86 | Ga0466692_054068 | 3300042591 | Bacteria | 1243 |
| 87 | Ga0466694_036489 | 3300042594 | Bacteria | 3828 |
| 88 | Ga0466724_24920 | 3300042649 | Bacteria | 2291 |
| 89 | Ga0466727_124526 | 3300042655 | Bacteria | 1054 |
| 90 | Ga0466727_260084 | 3300042655 | Bacteria | 1193 |
| 91 | Ga0466697_261008 | 3300042611 | Bacteria | 3357 |
| 92 | Ga0466719_268210 | 3300042606 | Bacteria | 2261 |
| 93 | Ga0466719_376067 | 3300042606 | Bacteria | 1016 |
| 94 | Ga0466705_526276 | 3300042612 | Unclassified | 1257 |
| 95 | Ga0466656_263736 | 3300042550 | Bacteria | 1387 |
| 96 | Ga0466691_166029 | 3300042593 | Bacteria | 1690 |
| 97 | Ga0466694_002184 | 3300042594 | Bacteria | 2234 |
| 98 | Ga0466694_206625 | 3300042594 | Bacteria | 1841 |
| 99 | Ga0466694_224307 | 3300042594 | Bacteria | 1039 |
| 100 | Ga0123353_12359509 | 3300010167 | Bacteria | 638 |
| 101 | Ga0466731_116378 | 3300042622 | Bacteria | 1007 |
| 102 | Ga0466734_032227 | 3300042623 | Bacteria | 1034 |
| 103 | Ga0466735_144145 | 3300042624 | Bacteria | 2252 |
| 104 | Ga0466703_199778 | 3300042636 | Bacteria | 2200 |
| 105 | Ga0466704_316838 | 3300042643 | Bacteria | 1021 |
| 106 | Ga0466727_023031 | 3300042655 | Bacteria | 4076 |
| 107 | Ga0466727_228660 | 3300042655 | Bacteria | 3560 |
| 108 | JGI24698J34947_10236213 | 3300002449 | Bacteria | 691 |
| 109 | JGI24696J40584_12928193 | 3300002834 | Bacteria | 1436 |
| 110 | JGI24696J40584_12954110 | 3300002834 | Bacteria | 2585 |
| 111 | Ga0466707_111285 | 3300042601 | Unclassified | 1325 |
| 112 | Ga0466716_323275 | 3300042605 | Bacteria | 3806 |
| 113 | Ga0466698_136325 | 3300042610 | Bacteria | 2089 |
| 114 | Ga0466715_034901 | 3300042616 | Bacteria | 4383 |
| 115 | Ga0466726_074736 | 3300042619 | Bacteria | 2819 |
| 116 | Ga0466726_165808 | 3300042619 | Bacteria | 1722 |
| 117 | Ga0466726_336100 | 3300042619 | Bacteria | 1322 |
| 118 | Ga0466726_392208 | 3300042619 | Bacteria | 1812 |
| 119 | Ga0466695_336858 | 3300042595 | Bacteria | 1140 |
| 120 | Ga0466699_221493 | 3300042597 | Bacteria | 2480 |
| 121 | Ga0123356_10989267 | 3300010049 | Bacteria | 1011 |
| 122 | Ga0466735_035879 | 3300042624 | Bacteria | 3376 |
| 123 | Ga0466703_245898 | 3300042636 | Bacteria | 2068 |
| 124 | Ga0466709_132011 | 3300042648 | Bacteria | 3731 |
| 125 | Ga0466727_095425 | 3300042655 | Bacteria | 2571 |
| 126 | Nasutiter_Contig02523 | 2030936001 | Bacteria | 514 |
| 127 | Ga0072941_1088927 | 3300005201 | Unclassified | 1440 |
| 128 | Ga0466732_039925 | 3300042656 | Bacteria | 1241 |
| 129 | Ga0466732_364768 | 3300042656 | Unclassified | 1059 |
| 130 | Ga0466700_260125 | 3300042600 | Bacteria | 1142 |
| 131 | Ga0466707_097872 | 3300042601 | Bacteria | 1053 |
| 132 | Ga0466719_205511 | 3300042606 | Bacteria | 1216 |
| 133 | Ga0466719_553060 | 3300042606 | Unclassified | 3030 |
| 134 | Ga0466720_062771 | 3300042607 | Bacteria | 2178 |
| 135 | Ga0466711_372634 | 3300042615 | Bacteria | 2697 |
| 136 | Ga0466715_165379 | 3300042616 | Bacteria | 1008 |
| 137 | Ga0466690_248283 | 3300042590 | Bacteria | 1809 |
| 138 | Ga0466693_228819 | 3300042592 | Bacteria | 1332 |
| 139 | Ga0466694_359982 | 3300042594 | Bacteria | 4356 |
| 140 | Ga0466699_019913 | 3300042597 | Bacteria | 4003 |
| 141 | Ga0466699_172490 | 3300042597 | Bacteria | 1094 |
| 142 | Ga0466699_295865 | 3300042597 | Bacteria | 4332 |
| 143 | Ga0466699_380280 | 3300042597 | Bacteria | 6562 |
| 144 | Ga0466699_380545 | 3300042597 | Bacteria | 1066 |
| 145 | Ga0123353_11892895 | 3300010167 | Bacteria | 736 |
| 146 | Ga0123353_12492547 | 3300010167 | Bacteria | 615 |
| 147 | Ga0466703_342434 | 3300042636 | Bacteria | 22917 |
| 148 | Ga0466704_044569 | 3300042643 | Bacteria | 1336 |
| 149 | Ga0466704_312296 | 3300042643 | Bacteria | 3442 |
| 150 | Ga0466704_437485 | 3300042643 | Bacteria | 2199 |
| 151 | Ga0466704_449195 | 3300042643 | Bacteria | 1735 |
| 152 | Ga0466704_618554 | 3300042643 | Bacteria | 8378 |
| 153 | JGI24698J34947_10099535 | 3300002449 | Bacteria | 1311 |
| 154 | JGI24696J40584_12865836 | 3300002834 | Bacteria | 1027 |
| 155 | Ga0074263_109818 | 3300005485 | Bacteria | 1916 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300038395 | Ga0415639_086929 | Ga0415639_086929_3007_3291 | 94 |
| 2 | 3300042597 | Ga0466699_172490 | Ga0466699_172490_267_551 | 94 |
| 3 | 3300042594 | Ga0466694_191084 | Ga0466694_191084_703_990 | 95 |
| 4 | 3300042597 | Ga0466699_221493 | Ga0466699_221493_100_387 | 95 |
| 5 | 3300042597 | Ga0466699_380545 | Ga0466699_380545_475_762 | 95 |
| 6 | 3300042607 | Ga0466720_058459 | Ga0466720_058459_1000_1287 | 95 |
| 7 | 3300042617 | Ga0466718_130531 | Ga0466718_130531_886_1173 | 95 |
| 8 | 3300005200 | Ga0072940_1138700 | Ga0072940_11387001 | 96 |
| 9 | 3300042550 | Ga0466656_192107 | Ga0466656_192107_468_758 | 96 |
| 10 | 3300042591 | Ga0466692_054068 | Ga0466692_054068_377_667 | 96 |
| 11 | 3300042592 | Ga0466693_228819 | Ga0466693_228819_756_1046 | 96 |
| 12 | 3300042593 | Ga0466691_166029 | Ga0466691_166029_1221_1511 | 96 |
| 13 | 3300042594 | Ga0466694_036489 | Ga0466694_036489_3424_3714 | 96 |
| 14 | 3300042594 | Ga0466694_039896 | Ga0466694_039896_2178_2468 | 96 |
| 15 | 3300042594 | Ga0466694_124625 | Ga0466694_124625_659_949 | 96 |
| 16 | 3300042594 | Ga0466694_162790 | Ga0466694_162790_1602_1892 | 96 |
| 17 | 3300042594 | Ga0466694_224307 | Ga0466694_224307_93_383 | 96 |
| 18 | 3300042595 | Ga0466695_336858 | Ga0466695_336858_210_500 | 96 |
| 19 | 3300042597 | Ga0466699_019913 | Ga0466699_019913_1707_1997 | 96 |
| 20 | 3300042597 | Ga0466699_104292 | Ga0466699_104292_551_841 | 96 |
| 21 | 3300042597 | Ga0466699_292100 | Ga0466699_292100_42_332 | 96 |
| 22 | 3300042597 | Ga0466699_295865 | Ga0466699_295865_3493_3783 | 96 |
| 23 | 3300042597 | Ga0466699_380280 | Ga0466699_380280_4177_4467 | 96 |
| 24 | 3300042598 | Ga0466701_052316 | Ga0466701_052316_2295_2585 | 96 |
| 25 | 3300042598 | Ga0466701_079883 | Ga0466701_079883_32_322 | 96 |
| 26 | 3300042600 | Ga0466700_136848 | Ga0466700_136848_456_746 | 96 |
| 27 | 3300042600 | Ga0466700_146676 | Ga0466700_146676_641_931 | 96 |
| 28 | 3300042600 | Ga0466700_260125 | Ga0466700_260125_486_776 | 96 |
| 29 | 3300042601 | Ga0466707_097872 | Ga0466707_097872_267_557 | 96 |
| 30 | 3300042601 | Ga0466707_111285 | Ga0466707_111285_946_1236 | 96 |
| 31 | 3300042601 | Ga0466707_229185 | Ga0466707_229185_1730_2020 | 96 |
| 32 | 3300042601 | Ga0466707_302822 | Ga0466707_302822_665_955 | 96 |
| 33 | 3300042601 | Ga0466707_351654 | Ga0466707_351654_863_1153 | 96 |
| 34 | 3300042605 | Ga0466716_081010 | Ga0466716_081010_1440_1730 | 96 |
| 35 | 3300042605 | Ga0466716_181002 | Ga0466716_181002_6543_6833 | 96 |
| 36 | 3300042606 | Ga0466719_268210 | Ga0466719_268210_1506_1796 | 96 |
| 37 | 3300042606 | Ga0466719_376067 | Ga0466719_376067_562_852 | 96 |
| 38 | 3300042607 | Ga0466720_062771 | Ga0466720_062771_690_980 | 96 |
| 39 | 3300042609 | Ga0466722_191644 | Ga0466722_191644_346_636 | 96 |
| 40 | 3300042610 | Ga0466698_105408 | Ga0466698_105408_2664_2954 | 96 |
| 41 | 3300042610 | Ga0466698_136325 | Ga0466698_136325_1258_1548 | 96 |
| 42 | 3300042611 | Ga0466697_261008 | Ga0466697_261008_2037_2327 | 96 |
| 43 | 3300042614 | Ga0466712_020763 | Ga0466712_020763_545_835 | 96 |
| 44 | 3300042614 | Ga0466712_032829 | Ga0466712_032829_1242_1532 | 96 |
| 45 | 3300042614 | Ga0466712_232812 | Ga0466712_232812_7690_7980 | 96 |
| 46 | 3300042614 | Ga0466712_268061 | Ga0466712_268061_2559_2849 | 96 |
| 47 | 3300042615 | Ga0466711_372634 | Ga0466711_372634_676_966 | 96 |
| 48 | 3300042617 | Ga0466718_026609 | Ga0466718_026609_75_365 | 96 |
| 49 | 3300042617 | Ga0466718_121863 | Ga0466718_121863_483_773 | 96 |
| 50 | 3300042619 | Ga0466726_336100 | Ga0466726_336100_703_993 | 96 |
| 51 | 3300042620 | Ga0466728_379470 | Ga0466728_379470_115_405 | 96 |
| 52 | 3300042621 | Ga0466729_141108 | Ga0466729_141108_1150_1440 | 96 |
| 53 | 3300042623 | Ga0466734_032227 | Ga0466734_032227_107_397 | 96 |
| 54 | 3300042624 | Ga0466735_035879 | Ga0466735_035879_501_791 | 96 |
| 55 | 3300042624 | Ga0466735_036181 | Ga0466735_036181_983_1273 | 96 |
| 56 | 3300042624 | Ga0466735_147934 | Ga0466735_147934_6724_7014 | 96 |
| 57 | 3300042624 | Ga0466735_185676 | Ga0466735_185676_514_804 | 96 |
| 58 | 3300042636 | Ga0466703_190320 | Ga0466703_190320_1645_1935 | 96 |
| 59 | 3300042643 | Ga0466704_044569 | Ga0466704_044569_168_458 | 96 |
| 60 | 3300042648 | Ga0466709_132011 | Ga0466709_132011_1600_1890 | 96 |
| 61 | 3300042656 | Ga0466732_039925 | Ga0466732_039925_128_418 | 96 |
| 62 | 3300042656 | Ga0466732_340691 | Ga0466732_340691_666_956 | 96 |
| 63 | 3300042656 | Ga0466732_364768 | Ga0466732_364768_17_307 | 96 |
| 64 | iso_pr_bacteria | 2740892546 | 2743910751 | 96 |
| 65 | 3300000089 | AustNasuHG_c1038486 | AustNasuHG_10384862 | 97 |
| 66 | 3300002449 | JGI24698J34947_10236213 | JGI24698J34947_102362132 | 97 |
| 67 | 3300002462 | JGI24702J35022_10041287 | JGI24702J35022_100412872 | 97 |
| 68 | 3300002834 | JGI24696J40584_12865836 | JGI24696J40584_128658361 | 97 |
| 69 | 3300002834 | JGI24696J40584_12954110 | JGI24696J40584_129541102 | 97 |
| 70 | 3300005200 | Ga0072940_1086054 | Ga0072940_10860544 | 97 |
| 71 | 3300005201 | Ga0072941_1020858 | Ga0072941_10208588 | 97 |
| 72 | 3300005201 | Ga0072941_1088927 | Ga0072941_10889272 | 97 |
| 73 | 3300005201 | Ga0072941_1384854 | Ga0072941_13848544 | 97 |
| 74 | 3300005485 | Ga0074263_109818 | Ga0074263_1098182 | 97 |
| 75 | 3300010049 | Ga0123356_10730305 | Ga0123356_107303052 | 97 |
| 76 | 3300010167 | Ga0123353_12359509 | Ga0123353_123595092 | 97 |
| 77 | 3300038395 | Ga0415639_029876 | Ga0415639_029876_660_953 | 97 |
| 78 | 3300042550 | Ga0466656_126397 | Ga0466656_126397_1044_1337 | 97 |
| 79 | 3300042550 | Ga0466656_263736 | Ga0466656_263736_191_484 | 97 |
| 80 | 3300042582 | Ga0466657_118463 | Ga0466657_118463_336_629 | 97 |
| 81 | 3300042590 | Ga0466690_124178 | Ga0466690_124178_337_630 | 97 |
| 82 | 3300042590 | Ga0466690_248283 | Ga0466690_248283_364_657 | 97 |
| 83 | 3300042594 | Ga0466694_002184 | Ga0466694_002184_689_982 | 97 |
| 84 | 3300042594 | Ga0466694_066240 | Ga0466694_066240_821_1114 | 97 |
| 85 | 3300042594 | Ga0466694_206625 | Ga0466694_206625_409_702 | 97 |
| 86 | 3300042594 | Ga0466694_359982 | Ga0466694_359982_2036_2329 | 97 |
| 87 | 3300042596 | Ga0466696_143990 | Ga0466696_143990_4948_5241 | 97 |
| 88 | 3300042596 | Ga0466696_333210 | Ga0466696_333210_486_779 | 97 |
| 89 | 3300042604 | Ga0466717_081096 | Ga0466717_081096_967_1260 | 97 |
| 90 | 3300042605 | Ga0466716_323275 | Ga0466716_323275_3069_3362 | 97 |
| 91 | 3300042606 | Ga0466719_399378 | Ga0466719_399378_430_723 | 97 |
| 92 | 3300042606 | Ga0466719_553060 | Ga0466719_553060_2312_2605 | 97 |
| 93 | 3300042607 | Ga0466720_170068 | Ga0466720_170068_25_318 | 97 |
| 94 | 3300042608 | Ga0466721_004056 | Ga0466721_004056_746_1039 | 97 |
| 95 | 3300042610 | Ga0466698_065312 | Ga0466698_065312_515_808 | 97 |
| 96 | 3300042610 | Ga0466698_467681 | Ga0466698_467681_667_960 | 97 |
| 97 | 3300042612 | Ga0466705_056888 | Ga0466705_056888_10_303 | 97 |
| 98 | 3300042612 | Ga0466705_199171 | Ga0466705_199171_595_888 | 97 |
| 99 | 3300042612 | Ga0466705_526276 | Ga0466705_526276_672_965 | 97 |
| 100 | 3300042615 | Ga0466711_042933 | Ga0466711_042933_218_511 | 97 |
| 101 | 3300042616 | Ga0466715_010076 | Ga0466715_010076_707_1000 | 97 |
| 102 | 3300042616 | Ga0466715_034901 | Ga0466715_034901_3362_3655 | 97 |
| 103 | 3300042616 | Ga0466715_148272 | Ga0466715_148272_302_595 | 97 |
| 104 | 3300042616 | Ga0466715_149698 | Ga0466715_149698_539_832 | 97 |
| 105 | 3300042616 | Ga0466715_165379 | Ga0466715_165379_169_462 | 97 |
| 106 | 3300042616 | Ga0466715_548299 | Ga0466715_548299_818_1111 | 97 |
| 107 | 3300042617 | Ga0466718_152595 | Ga0466718_152595_859_1152 | 97 |
| 108 | 3300042617 | Ga0466718_161485 | Ga0466718_161485_476_769 | 97 |
| 109 | 3300042619 | Ga0466726_074736 | Ga0466726_074736_263_556 | 97 |
| 110 | 3300042619 | Ga0466726_165808 | Ga0466726_165808_491_784 | 97 |
| 111 | 3300042619 | Ga0466726_240375 | Ga0466726_240375_558_851 | 97 |
| 112 | 3300042619 | Ga0466726_299180 | Ga0466726_299180_46_339 | 97 |
| 113 | 3300042619 | Ga0466726_392208 | Ga0466726_392208_1431_1724 | 97 |
| 114 | 3300042620 | Ga0466728_153150 | Ga0466728_153150_529_822 | 97 |
| 115 | 3300042622 | Ga0466731_116378 | Ga0466731_116378_12_305 | 97 |
| 116 | 3300042624 | Ga0466735_144145 | Ga0466735_144145_132_425 | 97 |
| 117 | 3300042636 | Ga0466703_199778 | Ga0466703_199778_1776_2069 | 97 |
| 118 | 3300042636 | Ga0466703_342434 | Ga0466703_342434_22232_22525 | 97 |
| 119 | 3300042643 | Ga0466704_312296 | Ga0466704_312296_405_698 | 97 |
| 120 | 3300042643 | Ga0466704_316838 | Ga0466704_316838_283_576 | 97 |
| 121 | 3300042643 | Ga0466704_437485 | Ga0466704_437485_1535_1828 | 97 |
| 122 | 3300042649 | Ga0466724_24920 | Ga0466724_24920_718_1011 | 97 |
| 123 | 3300042655 | Ga0466727_023031 | Ga0466727_023031_2465_2758 | 97 |
| 124 | 3300042655 | Ga0466727_050302 | Ga0466727_050302_2223_2516 | 97 |
| 125 | 3300042655 | Ga0466727_095425 | Ga0466727_095425_2175_2468 | 97 |
| 126 | 3300042655 | Ga0466727_124526 | Ga0466727_124526_54_347 | 97 |
| 127 | 3300042655 | Ga0466727_195759 | Ga0466727_195759_422_715 | 97 |
| 128 | 3300042655 | Ga0466727_228660 | Ga0466727_228660_643_936 | 97 |
| 129 | 3300042655 | Ga0466727_260084 | Ga0466727_260084_333_626 | 97 |
| 130 | 3300042656 | Ga0466732_301322 | Ga0466732_301322_1631_1924 | 97 |
| 131 | 3300042656 | Ga0466732_388680 | Ga0466732_388680_1357_1650 | 97 |
| 132 | 3300042656 | Ga0466732_440906 | Ga0466732_440906_1810_2103 | 97 |
| 133 | 3300002449 | JGI24698J34947_10099535 | JGI24698J34947_100995352 | 98 |
| 134 | 3300002450 | JGI24695J34938_10097188 | JGI24695J34938_100971882 | 98 |
| 135 | 3300002834 | JGI24696J40584_12512298 | JGI24696J40584_125122982 | 98 |
| 136 | 3300002834 | JGI24696J40584_12928193 | JGI24696J40584_129281931 | 98 |
| 137 | 3300005201 | Ga0072941_1088796 | Ga0072941_10887961 | 98 |
| 138 | 3300010049 | Ga0123356_10062511 | Ga0123356_100625113 | 98 |
| 139 | 3300010049 | Ga0123356_10989267 | Ga0123356_109892673 | 98 |
| 140 | 3300010049 | Ga0123356_10998998 | Ga0123356_109989982 | 98 |
| 141 | 3300010167 | Ga0123353_10922771 | Ga0123353_109227713 | 98 |
| 142 | 3300010167 | Ga0123353_11892895 | Ga0123353_118928952 | 98 |
| 143 | 3300010167 | Ga0123353_12492547 | Ga0123353_124925472 | 98 |
| 144 | 3300042602 | Ga0466713_114008 | Ga0466713_114008_448_744 | 98 |
| 145 | 3300042606 | Ga0466719_205511 | Ga0466719_205511_129_425 | 98 |
| 146 | 3300042606 | Ga0466719_398307 | Ga0466719_398307_250_546 | 98 |
| 147 | 3300042636 | Ga0466703_040418 | Ga0466703_040418_97_393 | 98 |
| 148 | 3300042636 | Ga0466703_245898 | Ga0466703_245898_494_790 | 98 |
| 149 | 3300042643 | Ga0466704_115886 | Ga0466704_115886_1674_1970 | 98 |
| 150 | 3300042643 | Ga0466704_449195 | Ga0466704_449195_978_1274 | 98 |
| 151 | 3300042643 | Ga0466704_526085 | Ga0466704_526085_700_996 | 98 |
| 152 | 3300042643 | Ga0466704_618554 | Ga0466704_618554_3832_4128 | 98 |
| 153 | 3300042655 | Ga0466727_058452 | Ga0466727_058452_27_323 | 98 |
| 154 | 2030936001 | Nasutiter_Contig02523 | Nasutiterm_1170070 | 102 |
| 155 | 3300042624 | Ga0466735_099228 | Ga0466735_099228_193_528 | 111 |
| 156 | 3300042606 | Ga0466719_421943 | Ga0466719_421943_348_695 | 115 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.