Protein Family IF05313
Metagenome
Isolate
126
Members
38
Samples
118
Scaffolds
427.32
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_164412|Ga0466699_164412_423_1814
- Length
- 463 aa
- Sequence
- LGKRQKNFRGTGAAAMSVQKTAGVSAKWIWFVDARYIFRKEKKSPSPVFSLLGIATGVFALIVIIAVMNGFQLGFIESILEISSYHIRIGNLPAGQISQEKIDEASAALLAVPGITAVVPFHEFQGLLRGRRGGQQAVLVRGLPSNALDLDRALAGRLEFEYGDFYFNGGDSVLLGAELAGRMGARIGDEINLFSIESVFFVFYSAEAGMRVFTVGGIFRTGFYEYDMGWAVIGINRAEAFCETGPVLGLKIKNRFHDRQMLELARNSLAVIAGFETAEFTSWRDYNRSFFGALRTEKLFMFILVGLIFIVVGLNIYQSQRRAVLEHREEIGLLRAVGGGERAVRLIFVCDGAIIGFTGALAGLIPGLLIASNIGTFFTVLEKIANFFINIVNFIAGFFGAAGTGNFSFFSPTVFYIKEIPSRVIPEEVLLIFMFGFLSALTAAWFASRKVSQIQPAEVLRYE
Sample Types
Isolate
6.3%
Metagenome
93.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.2%
Unclassified
25.0%
Kalotermitidae
13.9%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Hodotermitidae
2.8%
Taxonomy
Archaea
1
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 5 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 12 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 13 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 14 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 29 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10197865 | 3300010049 | Bacteria | 2047 |
| 2 | JGI24695J34938_10010759 | 3300002450 | Bacteria | 4977 |
| 3 | Ga0072940_1012703 | 3300005200 | Bacteria | 7559 |
| 4 | Ga0072941_1005556 | 3300005201 | Bacteria | 23397 |
| 5 | Ga0264413_108749 | 3300024493 | Bacteria | 8662 |
| 6 | Ga0264413_109614 | 3300024493 | Bacteria | 3723 |
| 7 | Ga0466699_012651 | 3300042597 | Bacteria | 13207 |
| 8 | Ga0466699_124852 | 3300042597 | Bacteria | 7971 |
| 9 | Ga0466699_134791 | 3300042597 | Bacteria | 2167 |
| 10 | Ga0466699_248293 | 3300042597 | Bacteria | 7769 |
| 11 | Ga0466699_387070 | 3300042597 | Bacteria | 9030 |
| 12 | Ga0466720_025899 | 3300042607 | Bacteria | 56735 |
| 13 | Ga0466720_196210 | 3300042607 | Bacteria | 16212 |
| 14 | Ga0466705_265345 | 3300042612 | Bacteria | 7968 |
| 15 | Ga0466732_062022 | 3300042656 | Bacteria | 12415 |
| 16 | Ga0466732_142701 | 3300042656 | Bacteria | 3491 |
| 17 | Ga0123356_10013186 | 3300010049 | Bacteria | 7994 |
| 18 | Ga0123356_10053648 | 3300010049 | Bacteria | 3753 |
| 19 | JGI24695J34938_10001518 | 3300002450 | Bacteria | 19554 |
| 20 | JGI24695J34938_10002203 | 3300002450 | Bacteria | 15193 |
| 21 | Ga0466692_056617 | 3300042591 | Bacteria | 76518 |
| 22 | Ga0466693_436085 | 3300042592 | Bacteria | 47244 |
| 23 | Ga0466699_008702 | 3300042597 | Bacteria | 3441 |
| 24 | Ga0466699_076091 | 3300042597 | Bacteria | 13285 |
| 25 | Ga0466699_151195 | 3300042597 | Bacteria | 4926 |
| 26 | Ga0466699_170812 | 3300042597 | Bacteria | 8923 |
| 27 | Ga0466699_272033 | 3300042597 | Bacteria | 1590 |
| 28 | Ga0466715_190904 | 3300042616 | Bacteria | 17122 |
| 29 | Ga0466718_035626 | 3300042617 | Bacteria | 6076 |
| 30 | Ga0466709_256148 | 3300042648 | Bacteria | 9428 |
| 31 | Ga0466720_031121 | 3300042607 | Bacteria | 38472 |
| 32 | Ga0466720_207313 | 3300042607 | Bacteria | 9180 |
| 33 | Ga0466722_070896 | 3300042609 | Bacteria | 8573 |
| 34 | Ga0466722_086299 | 3300042609 | Bacteria | 6763 |
| 35 | Ga0466732_252112 | 3300042656 | Bacteria | 23763 |
| 36 | Ga0123356_10000424 | 3300010049 | Bacteria | 48165 |
| 37 | JGI24698J34947_10009129 | 3300002449 | Bacteria | 5442 |
| 38 | Ga0072940_1021372 | 3300005200 | Bacteria | 1981 |
| 39 | Ga0072941_1005557 | 3300005201 | Unclassified | 3771 |
| 40 | Ga0264413_119715 | 3300024493 | Bacteria | 5510 |
| 41 | Ga0415639_060950 | 3300038395 | Bacteria | 8139 |
| 42 | Ga0466720_034302 | 3300042607 | Bacteria | 16753 |
| 43 | Ga0466720_125260 | 3300042607 | Bacteria | 23757 |
| 44 | Ga0466722_072288 | 3300042609 | Bacteria | 35823 |
| 45 | Ga0466722_138105 | 3300042609 | Bacteria | 3956 |
| 46 | Ga0466705_119080 | 3300042612 | Bacteria | 13162 |
| 47 | AustNasuHG_c1003860 | 3300000089 | Bacteria | 5398 |
| 48 | Ga0264413_109381 | 3300024493 | Bacteria | 5102 |
| 49 | Ga0415639_084087 | 3300038395 | Bacteria | 13313 |
| 50 | Ga0466692_114671 | 3300042591 | Bacteria | 7918 |
| 51 | Ga0466699_060715 | 3300042597 | Bacteria | 3170 |
| 52 | Ga0466699_164412 | 3300042597 | Bacteria | 3293 |
| 53 | Ga0466699_186375 | 3300042597 | Bacteria | 32333 |
| 54 | Ga0466699_216693 | 3300042597 | Bacteria | 5872 |
| 55 | Ga0466720_033743 | 3300042607 | Bacteria | 60959 |
| 56 | Ga0466720_154916 | 3300042607 | Bacteria | 17029 |
| 57 | Ga0466722_067148 | 3300042609 | Bacteria | 1365 |
| 58 | Ga0466732_114344 | 3300042656 | Bacteria | 23924 |
| 59 | AustNasuHG_c1010691 | 3300000089 | Bacteria | 3194 |
| 60 | JGI24695J34938_10009636 | 3300002450 | Bacteria | 5357 |
| 61 | JGI24705J35276_12223941 | 3300002504 | Bacteria | 2559 |
| 62 | Ga0264413_109617 | 3300024493 | Bacteria | 6355 |
| 63 | Ga0264413_109688 | 3300024493 | Bacteria | 5425 |
| 64 | Ga0466699_074386 | 3300042597 | Bacteria | 15229 |
| 65 | Ga0466699_363856 | 3300042597 | Bacteria | 5726 |
| 66 | Ga0466712_159857 | 3300042614 | Bacteria | 3061 |
| 67 | Ga0466718_082810 | 3300042617 | Bacteria | 20578 |
| 68 | Ga0466718_093124 | 3300042617 | Bacteria | 9460 |
| 69 | Ga0466703_204264 | 3300042636 | Bacteria | 8670 |
| 70 | Ga0466720_001126 | 3300042607 | Bacteria | 5795 |
| 71 | Ga0466722_066738 | 3300042609 | Unclassified | 1308 |
| 72 | Ga0466722_154573 | 3300042609 | Bacteria | 5072 |
| 73 | Ga0466722_219069 | 3300042609 | Bacteria | 6596 |
| 74 | AustNasuHG_c1001678 | 3300000089 | Bacteria | 7986 |
| 75 | JGI24698J34947_10009654 | 3300002449 | Bacteria | 5287 |
| 76 | JGI24695J34938_10001836 | 3300002450 | Bacteria | 17306 |
| 77 | JGI24695J34938_10002085 | 3300002450 | Bacteria | 15669 |
| 78 | Ga0072940_1033004 | 3300005200 | Bacteria | 18577 |
| 79 | Ga0264413_104838 | 3300024493 | Bacteria | 10845 |
| 80 | Ga0264413_109615 | 3300024493 | Bacteria | 4147 |
| 81 | Ga0264413_117571 | 3300024493 | Bacteria | 5288 |
| 82 | Ga0466694_123331 | 3300042594 | Bacteria | 14534 |
| 83 | Ga0466694_181192 | 3300042594 | Bacteria | 3569 |
| 84 | Ga0466718_148796 | 3300042617 | Bacteria | 2169 |
| 85 | Ga0466726_029240 | 3300042619 | Bacteria | 4083 |
| 86 | Ga0466727_140980 | 3300042655 | Bacteria | 1623 |
| 87 | Ga0466706_182284 | 3300042599 | Archaea | 2397 |
| 88 | Ga0466720_073424 | 3300042607 | Bacteria | 22318 |
| 89 | Ga0466698_436664 | 3300042610 | Bacteria | 1731 |
| 90 | Ga0466732_312754 | 3300042656 | Bacteria | 1347 |
| 91 | Ga0123355_10059406 | 3300009826 | Unclassified | 6180 |
| 92 | Ga0123356_10004189 | 3300010049 | Bacteria | 14952 |
| 93 | JGI24695J34938_10000446 | 3300002450 | Bacteria | 39944 |
| 94 | Ga0264413_102958 | 3300024493 | Bacteria | 8604 |
| 95 | Ga0264413_106871 | 3300024493 | Bacteria | 14804 |
| 96 | Ga0466718_127023 | 3300042617 | Bacteria | 10226 |
| 97 | Ga0466719_199083 | 3300042606 | Bacteria | 19265 |
| 98 | Ga0466720_081695 | 3300042607 | Bacteria | 38075 |
| 99 | Ga0466720_205466 | 3300042607 | Bacteria | 4709 |
| 100 | Ga0466698_040838 | 3300042610 | Bacteria | 1550 |
| 101 | Ga0123356_10001823 | 3300010049 | Bacteria | 23151 |
| 102 | Ga0123356_10014616 | 3300010049 | Bacteria | 7545 |
| 103 | JGI24698J34947_10033772 | 3300002449 | Bacteria | 2681 |
| 104 | JGI24695J34938_10000201 | 3300002450 | Bacteria | 56424 |
| 105 | JGI24695J34938_10000659 | 3300002450 | Bacteria | 32678 |
| 106 | Ga0072940_1001054 | 3300005200 | Bacteria | 8086 |
| 107 | Ga0072940_1001997 | 3300005200 | Bacteria | 10646 |
| 108 | Ga0264413_116815 | 3300024493 | Bacteria | 2816 |
| 109 | Ga0466694_164977 | 3300042594 | Bacteria | 16325 |
| 110 | Ga0466699_300066 | 3300042597 | Bacteria | 5478 |
| 111 | Ga0466705_436413 | 3300042612 | Bacteria | 1779 |
| 112 | Ga0466712_148959 | 3300042614 | Bacteria | 8739 |
| 113 | Ga0466715_100553 | 3300042616 | Bacteria | 10769 |
| 114 | Ga0466718_003072 | 3300042617 | Bacteria | 21491 |
| 115 | Ga0466718_026950 | 3300042617 | Bacteria | 19873 |
| 116 | Ga0466707_133240 | 3300042601 | Bacteria | 4130 |
| 117 | Ga0466720_139182 | 3300042607 | Bacteria | 5972 |
| 118 | Ga0466721_384222 | 3300042608 | Bacteria | 17220 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02687 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.