Protein Family IF05286
Metagenome
Metatranscriptome
Isolate
193
Members
49
Samples
188
Scaffolds
261.43
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_069925|Ga0466699_069925_1772_2674
- Length
- 300 aa
- Sequence
- VPDSSSAIADSKSIPIKSQTSQRLDTIPDVQNQEDKRNVPLAKVGVKGLEYPIQVLDKVKKVQHTAAKVDLFADLPRHFKGTHMSRFIEIFHQYRDDLSMPRFMEMLSAIRAELDAESAYGSMEFPYFIEKKAPVSGLPGMMSYRCRYQGRVSAGPQSVAGNEAPGSGIKKERHFTVAVSVPVTTVCPCSKAISERGAHNQRGNVTVELELGPFFWIEDIIDIVESVASSPVYSILKREDEKFITEHAYDNPRFVEDLVRDVYNTIKELNQFPRFSVEAENFESIHNHSAFAFAEYDKEG
Sample Types
Isolate
2.6%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
30.4%
Unclassified
15.2%
Termopsidae
6.5%
Rhinotermitidae
4.3%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
179
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_295574 | 3300042612 | Bacteria | 6076 |
| 2 | Ga0466735_192573 | 3300042624 | Bacteria | 1978 |
| 3 | Ga0466704_231866 | 3300042643 | Bacteria | 63702 |
| 4 | Ga0466708_085331 | 3300042652 | Bacteria | 23949 |
| 5 | Ga0466727_282223 | 3300042655 | Bacteria | 3220 |
| 6 | Ga0466715_350658 | 3300042616 | Bacteria | 11961 |
| 7 | Ga0466715_451531 | 3300042616 | Bacteria | 18226 |
| 8 | Ga0466726_415241 | 3300042619 | Bacteria | 2971 |
| 9 | Ga0223674_1017648 | 3300021235 | Unclassified | 965 |
| 10 | Ga0466694_129910 | 3300042594 | Bacteria | 1258 |
| 11 | Ga0466696_078122 | 3300042596 | Bacteria | 22384 |
| 12 | Ga0466696_412850 | 3300042596 | Bacteria | 4333 |
| 13 | Ga0466699_025738 | 3300042597 | Bacteria | 2365 |
| 14 | Ga0466706_247090 | 3300042599 | Bacteria | 1296 |
| 15 | Ga0466707_041575 | 3300042601 | Bacteria | 1692 |
| 16 | Ga0466719_247571 | 3300042606 | Bacteria | 11927 |
| 17 | JGI24698J34947_10019313 | 3300002449 | Bacteria | 3676 |
| 18 | Ga0466732_148116 | 3300042656 | Bacteria | 3033 |
| 19 | Ga0466703_092123 | 3300042636 | Bacteria | 4611 |
| 20 | Ga0466708_031310 | 3300042652 | Bacteria | 1715 |
| 21 | Ga0466708_052925 | 3300042652 | Bacteria | 30385 |
| 22 | Ga0466727_219533 | 3300042655 | Bacteria | 2858 |
| 23 | Ga0466712_290554 | 3300042614 | Bacteria | 2453 |
| 24 | Ga0466711_242096 | 3300042615 | Bacteria | 13657 |
| 25 | Ga0466711_329979 | 3300042615 | Bacteria | 8770 |
| 26 | Ga0466715_066271 | 3300042616 | Bacteria | 8765 |
| 27 | Ga0466718_006747 | 3300042617 | Unclassified | 2562 |
| 28 | Ga0466726_007648 | 3300042619 | Bacteria | 1429 |
| 29 | Ga0466726_184565 | 3300042619 | Bacteria | 1120 |
| 30 | Ga0466726_292770 | 3300042619 | Bacteria | 1175 |
| 31 | Ga0466726_410830 | 3300042619 | Bacteria | 1526 |
| 32 | Ga0466692_016689 | 3300042591 | Bacteria | 2732 |
| 33 | Ga0466691_184150 | 3300042593 | Bacteria | 3143 |
| 34 | Ga0466699_069925 | 3300042597 | Bacteria | 3307 |
| 35 | Ga0466699_206956 | 3300042597 | Bacteria | 3485 |
| 36 | Ga0466707_019657 | 3300042601 | Bacteria | 2862 |
| 37 | Ga0466707_136469 | 3300042601 | Bacteria | 8632 |
| 38 | Ga0466707_258494 | 3300042601 | Bacteria | 1392 |
| 39 | Ga0466713_144751 | 3300042602 | Bacteria | 3125 |
| 40 | Ga0466720_092079 | 3300042607 | Bacteria | 1922 |
| 41 | Ga0123357_10119838 | 3300009784 | Bacteria | 3319 |
| 42 | Ga0123353_10195668 | 3300010167 | Bacteria | 3187 |
| 43 | JGI24698J34947_10010035 | 3300002449 | Bacteria | 5189 |
| 44 | JGI24702J35022_10105763 | 3300002462 | Bacteria | 1544 |
| 45 | Ga0466703_394860 | 3300042636 | Bacteria | 2767 |
| 46 | Ga0466704_332674 | 3300042643 | Bacteria | 27618 |
| 47 | Ga0466708_357081 | 3300042652 | Bacteria | 48632 |
| 48 | Ga0466708_446408 | 3300042652 | Bacteria | 8307 |
| 49 | Ga0466712_021118 | 3300042614 | Bacteria | 10327 |
| 50 | Ga0466711_034357 | 3300042615 | Bacteria | 2124 |
| 51 | Ga0466715_319197 | 3300042616 | Bacteria | 2055 |
| 52 | Ga0466715_502721 | 3300042616 | Bacteria | 25849 |
| 53 | Ga0466723_178691 | 3300042618 | Bacteria | 59067 |
| 54 | Ga0466690_110341 | 3300042590 | Bacteria | 2463 |
| 55 | Ga0466690_201039 | 3300042590 | Bacteria | 1539 |
| 56 | Ga0466691_024281 | 3300042593 | Bacteria | 18067 |
| 57 | Ga0466694_358916 | 3300042594 | Bacteria | 12800 |
| 58 | Ga0466707_173284 | 3300042601 | Unclassified | 1605 |
| 59 | Ga0466707_205093 | 3300042601 | Unclassified | 5626 |
| 60 | Ga0466719_296364 | 3300042606 | Bacteria | 4664 |
| 61 | Ga0466720_097099 | 3300042607 | Unclassified | 2020 |
| 62 | Ga0466698_359215 | 3300042610 | Unclassified | 1607 |
| 63 | Ga0123353_10551221 | 3300010167 | Bacteria | 1663 |
| 64 | Ga0072941_1000052 | 3300005201 | Bacteria | 17330 |
| 65 | Ga0466703_060341 | 3300042636 | Bacteria | 36311 |
| 66 | Ga0466703_124193 | 3300042636 | Bacteria | 4621 |
| 67 | Ga0466703_197998 | 3300042636 | Bacteria | 15132 |
| 68 | Ga0466704_302790 | 3300042643 | Bacteria | 6533 |
| 69 | Ga0466709_008701 | 3300042648 | Bacteria | 5914 |
| 70 | Ga0466709_267528 | 3300042648 | Bacteria | 7053 |
| 71 | Ga0466708_005588 | 3300042652 | Bacteria | 17842 |
| 72 | Ga0466708_134469 | 3300042652 | Bacteria | 57083 |
| 73 | Ga0466708_345489 | 3300042652 | Bacteria | 2945 |
| 74 | Ga0466705_474941 | 3300042612 | Bacteria | 29700 |
| 75 | Ga0466715_035143 | 3300042616 | Bacteria | 4244 |
| 76 | Ga0466718_001188 | 3300042617 | Bacteria | 1271 |
| 77 | Ga0466723_024004 | 3300042618 | Bacteria | 1608 |
| 78 | Ga0466723_199067 | 3300042618 | Bacteria | 1808 |
| 79 | Ga0466723_251195 | 3300042618 | Bacteria | 7180 |
| 80 | Ga0466726_383033 | 3300042619 | Bacteria | 1002 |
| 81 | Ga0466692_112011 | 3300042591 | Bacteria | 11180 |
| 82 | Ga0466691_076974 | 3300042593 | Bacteria | 2093 |
| 83 | Ga0466707_095952 | 3300042601 | Bacteria | 1053 |
| 84 | Ga0466707_206676 | 3300042601 | Unclassified | 4099 |
| 85 | Ga0466707_396590 | 3300042601 | Bacteria | 1138 |
| 86 | Ga0466716_097741 | 3300042605 | Bacteria | 5340 |
| 87 | Ga0466716_194371 | 3300042605 | Bacteria | 1017 |
| 88 | Ga0466720_024112 | 3300042607 | Bacteria | 4970 |
| 89 | Ga0466720_084325 | 3300042607 | Bacteria | 1436 |
| 90 | Ga0466722_096376 | 3300042609 | Bacteria | 1967 |
| 91 | Ga0123355_10481717 | 3300009826 | Bacteria | 1543 |
| 92 | Ga0123353_10393671 | 3300010167 | Bacteria | 2066 |
| 93 | JGI24698J34947_10001357 | 3300002449 | Bacteria | 12864 |
| 94 | Ga0466705_146739 | 3300042612 | Bacteria | 16598 |
| 95 | Ga0466732_289290 | 3300042656 | Bacteria | 5531 |
| 96 | Ga0466703_067327 | 3300042636 | Bacteria | 7100 |
| 97 | Ga0466709_366977 | 3300042648 | Bacteria | 1741 |
| 98 | Ga0466712_171403 | 3300042614 | Bacteria | 7249 |
| 99 | Ga0466712_234398 | 3300042614 | Bacteria | 23834 |
| 100 | Ga0466715_120929 | 3300042616 | Bacteria | 51611 |
| 101 | Ga0466715_207754 | 3300042616 | Bacteria | 1936 |
| 102 | Ga0466715_231017 | 3300042616 | Bacteria | 2789 |
| 103 | Ga0466723_032563 | 3300042618 | Bacteria | 12635 |
| 104 | Ga0466723_033794 | 3300042618 | Bacteria | 16212 |
| 105 | Ga0466726_408767 | 3300042619 | Bacteria | 14543 |
| 106 | Ga0466690_027911 | 3300042590 | Bacteria | 7830 |
| 107 | Ga0466695_391309 | 3300042595 | Bacteria | 3808 |
| 108 | Ga0466696_129236 | 3300042596 | Bacteria | 6759 |
| 109 | Ga0466699_022974 | 3300042597 | Bacteria | 1297 |
| 110 | Ga0466707_201136 | 3300042601 | Bacteria | 1506 |
| 111 | Ga0466716_001522 | 3300042605 | Bacteria | 1863 |
| 112 | Ga0466716_049358 | 3300042605 | Bacteria | 7800 |
| 113 | Ga0466719_262002 | 3300042606 | Bacteria | 2660 |
| 114 | Ga0123353_10140697 | 3300010167 | Bacteria | 3866 |
| 115 | AustNasuHG_c1015324 | 3300000089 | Bacteria | 2589 |
| 116 | JGI24698J34947_10002848 | 3300002449 | Bacteria | 9378 |
| 117 | Ga0466705_184565 | 3300042612 | Bacteria | 3105 |
| 118 | Ga0466705_250564 | 3300042612 | Bacteria | 23311 |
| 119 | Ga0466709_029061 | 3300042648 | Bacteria | 3332 |
| 120 | Ga0466709_286065 | 3300042648 | Bacteria | 1932 |
| 121 | Ga0466705_432105 | 3300042612 | Unclassified | 1493 |
| 122 | Ga0466712_104952 | 3300042614 | Bacteria | 9088 |
| 123 | Ga0466718_024315 | 3300042617 | Bacteria | 6455 |
| 124 | Ga0466718_088682 | 3300042617 | Bacteria | 1116 |
| 125 | Ga0466726_158484 | 3300042619 | Bacteria | 4836 |
| 126 | Ga0466726_224017 | 3300042619 | Bacteria | 1761 |
| 127 | Ga0466728_082524 | 3300042620 | Bacteria | 7262 |
| 128 | Ga0264413_134354 | 3300024493 | Unclassified | 3000 |
| 129 | Ga0466692_004081 | 3300042591 | Bacteria | 13041 |
| 130 | Ga0466694_226894 | 3300042594 | Bacteria | 33377 |
| 131 | Ga0466699_219588 | 3300042597 | Bacteria | 1679 |
| 132 | Ga0466700_418315 | 3300042600 | Bacteria | 2106 |
| 133 | Ga0466707_160193 | 3300042601 | Unclassified | 2489 |
| 134 | Ga0466707_328029 | 3300042601 | Bacteria | 1124 |
| 135 | Ga0466720_082576 | 3300042607 | Bacteria | 3703 |
| 136 | Ga0123353_10314299 | 3300010167 | Bacteria | 2382 |
| 137 | JGI24698J34947_10002275 | 3300002449 | Bacteria | 10300 |
| 138 | JGI24695J34938_10011344 | 3300002450 | Bacteria | 4805 |
| 139 | JGI24702J35022_10047397 | 3300002462 | Bacteria | 2287 |
| 140 | Ga0123357_10002420 | 3300009784 | Bacteria | 20821 |
| 141 | Ga0466732_027430 | 3300042656 | Bacteria | 4782 |
| 142 | Ga0466735_000892 | 3300042624 | Bacteria | 6602 |
| 143 | Ga0466704_165078 | 3300042643 | Bacteria | 45623 |
| 144 | Ga0466715_102574 | 3300042616 | Bacteria | 10967 |
| 145 | Ga0466715_137419 | 3300042616 | Bacteria | 25736 |
| 146 | Ga0466715_242056 | 3300042616 | Unclassified | 1974 |
| 147 | Ga0466715_331197 | 3300042616 | Bacteria | 28574 |
| 148 | Ga0466694_052995 | 3300042594 | Bacteria | 3908 |
| 149 | Ga0466699_057456 | 3300042597 | Bacteria | 12121 |
| 150 | Ga0466699_205725 | 3300042597 | Bacteria | 1590 |
| 151 | Ga0466707_004548 | 3300042601 | Bacteria | 1444 |
| 152 | Ga0466707_337808 | 3300042601 | Bacteria | 1270 |
| 153 | Ga0466713_007267 | 3300042602 | Bacteria | 1878 |
| 154 | Ga0466719_277901 | 3300042606 | Bacteria | 6351 |
| 155 | Ga0466719_345503 | 3300042606 | Bacteria | 3160 |
| 156 | Ga0466720_115338 | 3300042607 | Bacteria | 2553 |
| 157 | Ga0466698_289866 | 3300042610 | Bacteria | 1078 |
| 158 | Ga0466698_349942 | 3300042610 | Bacteria | 1194 |
| 159 | Ga0123355_10002596 | 3300009826 | Bacteria | 25617 |
| 160 | Ga0123356_10544154 | 3300010049 | Bacteria | 1321 |
| 161 | JGI24702J35022_10019781 | 3300002462 | Bacteria | 3662 |
| 162 | Ga0072940_1006697 | 3300005200 | Bacteria | 1271 |
| 163 | Ga0466705_129672 | 3300042612 | Bacteria | 4157 |
| 164 | Ga0466705_323749 | 3300042612 | Bacteria | 6312 |
| 165 | Ga0466735_150980 | 3300042624 | Bacteria | 1467 |
| 166 | Ga0466727_344369 | 3300042655 | Bacteria | 1790 |
| 167 | Ga0466712_122631 | 3300042614 | Bacteria | 4893 |
| 168 | Ga0466711_515586 | 3300042615 | Bacteria | 3362 |
| 169 | Ga0466718_025245 | 3300042617 | Bacteria | 12416 |
| 170 | Ga0466718_027528 | 3300042617 | Unclassified | 1677 |
| 171 | Ga0466718_049937 | 3300042617 | Bacteria | 6712 |
| 172 | Ga0466723_218498 | 3300042618 | Bacteria | 4355 |
| 173 | Ga0466726_211141 | 3300042619 | Bacteria | 3961 |
| 174 | Ga0466728_233797 | 3300042620 | Bacteria | 6632 |
| 175 | Ga0264413_121445 | 3300024493 | Unclassified | 10882 |
| 176 | Ga0466690_207725 | 3300042590 | Bacteria | 21896 |
| 177 | Ga0466692_182186 | 3300042591 | Bacteria | 2098 |
| 178 | Ga0466691_052968 | 3300042593 | Bacteria | 6617 |
| 179 | Ga0466691_118331 | 3300042593 | Bacteria | 63226 |
| 180 | Ga0466691_160120 | 3300042593 | Bacteria | 9183 |
| 181 | Ga0466691_198354 | 3300042593 | Unclassified | 5142 |
| 182 | Ga0466694_409666 | 3300042594 | Bacteria | 1187 |
| 183 | Ga0466699_259926 | 3300042597 | Bacteria | 1055 |
| 184 | Ga0466716_145128 | 3300042605 | Bacteria | 7570 |
| 185 | Ga0466720_099086 | 3300042607 | Bacteria | 2182 |
| 186 | Ga0123354_10075387 | 3300010882 | Bacteria | 4824 |
| 187 | AustNasuHG_c1000805 | 3300000089 | Bacteria | 11243 |
| 188 | JGI24702J35022_10000912 | 3300002462 | Bacteria | 18394 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02649 | GCHY-1 | Type I GTP cyclohydrolase folE2 | 27 | 292 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02649 | GO:0003934 | GTP cyclohydrolase I activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.